SecReT6
Effector Protein ID: 556576624
-
SecReT6 ID868
T6SS typeA4b
Gene symbol-
Locus tagBBK_92
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome I [GenBank: NC_022659] [Browse all T6SS(s) in this replicon]
Location [Strand]121787..123109 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I2698
DescriptionTle1
UniProt IDU5UWE1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2235 [PF09994], Evalue: 1.30E-10, Aligned region: 5..47
Protein Sequence: 440 a.a.     [Download]
>gi|556576624|ref|YP_008742701.1| hypothetical protein BBK_92 [Burkholderia pseudomallei NCTC 13179]
MDGREEIVYPGVHSDVGGGYGPGEQGRGRDDADKLSQVPLLDMYREARKAGVPLDINGPGIGADVIAAFK
VSAGLKQAFAAYVKKSENYYYEKDHGTPGLMRCHYGLYLRWRKMRLKDMHAQPSFKAAQARYPQDAADLD
SANAELREEWNDLLEVEKAGGPTITRYVEKFVTKWASENPKTAAVVSTSLLPAAVAAEVFVPGVSAATVL
FGDKVVKLVQAQLKEKWEQWLQVRSDWNMGPPEPAISALYDNYMHDSRAWFKPLGDDDDVWNHRQIQELK
TKQASFERAHAAWKKRVEMGMPSPLQVTQAMGVGSTGWGPVGGLPPEPEPRSPLTAQQADLLKRYDAAMQ
SAKQARAAKDPNAPTDSAVLTDPKVTGGLALQTSGREFYFLWGFLRWRTVFVNGVRWDQPRVPTVQEEME
GMRMQMQRQVDMKGIGVLFQ
-
Nucleotide Sequence: 1323 bp     [Download]
>gi|556574580|ref|NC_022659.1|:c123109-121787 Burkholderia pseudomallei NCTC 13179 chromosome 1, complete sequence
ATGGACGGTCGTGAGGAGATTGTCTACCCGGGTGTTCACTCGGACGTCGGCGGCGGCTATGGGCCGGGCG
AACAGGGGCGCGGCCGGGACGACGCCGACAAACTTTCGCAAGTCCCGCTGCTTGATATGTACCGGGAGGC
GCGTAAGGCAGGTGTGCCCTTGGATATCAATGGGCCGGGTATCGGCGCGGACGTCATCGCTGCGTTCAAG
GTTTCAGCAGGGCTAAAACAAGCCTTCGCAGCCTACGTAAAAAAGAGCGAGAACTATTATTACGAGAAAG
ATCACGGCACGCCGGGCCTAATGCGTTGCCATTACGGCTTGTATCTCCGGTGGCGCAAGATGCGGCTCAA
GGACATGCATGCACAGCCCAGCTTCAAGGCTGCGCAGGCGCGCTATCCGCAAGATGCAGCGGATCTGGAC
AGTGCGAACGCGGAATTGAGGGAGGAGTGGAACGATTTGCTGGAGGTCGAGAAAGCTGGCGGCCCGACAA
TCACCCGATACGTGGAGAAGTTTGTTACGAAATGGGCCAGTGAGAATCCGAAAACGGCCGCCGTCGTTTC
CACGTCTCTACTTCCGGCCGCGGTCGCTGCTGAGGTTTTTGTTCCGGGGGTTAGCGCTGCGACGGTTCTA
TTCGGCGACAAAGTGGTGAAACTGGTGCAAGCCCAACTCAAGGAGAAGTGGGAGCAGTGGCTGCAAGTTC
GCAGCGACTGGAACATGGGGCCGCCTGAACCTGCGATCAGCGCACTCTACGACAACTACATGCACGACTC
CCGCGCATGGTTCAAGCCGCTCGGCGACGATGACGACGTGTGGAACCATAGGCAGATTCAGGAACTCAAG
ACCAAGCAAGCCAGCTTTGAACGCGCCCATGCTGCCTGGAAAAAGCGTGTCGAAATGGGCATGCCAAGCC
CGTTGCAGGTTACACAGGCAATGGGCGTAGGTTCCACAGGATGGGGGCCCGTCGGCGGGCTTCCGCCCGA
ACCCGAACCCCGCTCCCCGCTCACCGCCCAGCAAGCCGATCTGCTCAAGCGCTACGACGCCGCGATGCAG
TCCGCCAAGCAGGCACGCGCCGCAAAGGACCCGAACGCGCCGACGGACAGCGCCGTGCTGACCGATCCGA
AGGTGACGGGCGGCCTCGCGCTGCAAACCAGCGGCCGCGAGTTCTATTTCCTGTGGGGCTTCCTGCGCTG
GCGGACCGTGTTCGTGAACGGCGTGCGCTGGGACCAGCCGCGCGTGCCGACGGTGCAGGAGGAAATGGAG
GGCATGCGCATGCAGATGCAACGCCAGGTCGACATGAAGGGCATCGGCGTACTGTTCCAATGA