SecReT6
Effector Protein ID: 556577169
-
SecReT6 ID868
T6SS typeA4b
Gene symbol-
Locus tagBBK_91
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome I [GenBank: NC_022659] [Browse all T6SS(s) in this replicon]
Location [Strand]118343..121678 [-]
ProductRhs element Vgr family protein
Effector typeProtein
Homologous effectorBTH_I2697
Descriptiontype VI secretion system Vgr family protein
UniProt IDU5UXY1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.90E-51, Aligned region: 35..340
Phage_GPD [PF05954], Evalue: 5.90E-51, Aligned region: 668..770
DUF2345 [PF10106], Evalue: 1.70E-48, Aligned region: 588..636
DUF2345 [PF10106], Evalue: 1.70E-48, Aligned region: 667..820
T6SS_Vgr [PF13296], Evalue: 8.30E-31, Aligned region: 516..623
T6SS_Vgr [PF13296], Evalue: 8.30E-31, Aligned region: 693..720
Phage_base_V [PF04717], Evalue: 3.40E-15, Aligned region: 384..497
Phage_base_V [PF04717], Evalue: 3.40E-15, Aligned region: 576..589
Protein Sequence: 1111 a.a.     [Download]
>gi|556577169|ref|YP_008742700.1| Rhs element Vgr family protein [Burkholderia pseudomallei NCTC 13179]
MDLVAALTGYSQTTRHIRIDTAMPGAFVVERFHGREGVNESFRFEIDVLSSEPFLDLTPLIGHAARLRLA
TGAGERSWNGYVTHAAYADSDGEITRYRLTMESWLALLRLRRNCLYFVDVDTKDICERVFGDYPQARWRY
ELKEPLRKFSLRGQYRETDDTFVLRQLAEAGLSFRIEHAQDAGKEASGDHTVVVFDRRAPFRHGSTIAYN
LQDVGDPDGVITQFSERHQMVPDRVVATSWKADELLALAGHAQQPPEDKAPVLPVREIYDGQRAGRFDTI
DDAQRFAEQRLDALRLPKRIHYGAGSSRTLEIGAVHTLAGYLDRAITFVPLSIEHEAVNNLGADIGALLG
RGELDKGLYRNRFVAVPDGTPIVPPHRDRPIVHGVQTAIVVGEAGSRVSSTRDHQVRVQFPWMRGTAPLP
GGLTDTASRSNPAGHAPGDHRSGVLARVAESSAGPNFGHAFTPRVGAEVVIGFESGNIDMPVVLGQVYGG
RVQPPFAAGEGSDANHPGTLTGLQTQTLDGQSGSRWVMDDAAGQLRHELSNSTANSRLAQGYLIDQQGAM
RGAYRGEGFELATDGWGVVRAGEGVLVSSTARRLATSTQMDVAQSVGQLKQAVRTAQGMSESAAAAHAGG
LAANAAQADFLKAIDPAQDGKYTGAVNGQSATKASGAQRDGGEPVERFAAPAVLMESPENIVLTTPHSAV
SYAAQHVHLTAQRDAHVAAAATVAAASGDAVSLYAAAGGLRAIASDGPVSVEAHTSTMEILADQSVRITS
TDDRIDVLAKDAIVLQQGPNRITLKGGDITVETPGQFLVKSGAHPFPGPAAQSVSLPPLPIPAPLALFDE
QIRFVNEDGEPLGNVAYQLKLADGSTVSGVTDDNGRTERVSTDGPTAIQSATLTPTQVVDCCGRTSDVPP
PAVKVDIKGVGTHDTLVGSSEQSVTVKGESRPLTDGEIEMAKTVFQDSIDYSAVRVHKGSYFWFNLQSKR
TAVTPNNTMYFREEDFVEDFSVVSEEYPRRGWFMHEMTHVWQHQRGYAVRWHALTVTIRGESAYRYEIEP
GQVFSDFNMEQQGNLVSDYFALIVVDNRGELIHAQPGSKNQLRQVLAPLLQDPKDASNLPK
-
Nucleotide Sequence: 3336 bp     [Download]
>gi|556574580|ref|NC_022659.1|:c121678-118343 Burkholderia pseudomallei NCTC 13179 chromosome 1, complete sequence
ATGGATTTAGTCGCCGCATTGACGGGCTATTCTCAAACGACTCGCCACATCCGGATCGACACGGCGATGC
CGGGCGCGTTCGTGGTCGAACGTTTTCATGGGCGCGAGGGCGTCAACGAATCGTTTCGCTTCGAGATCGA
CGTGCTGTCGAGCGAGCCGTTTCTCGATCTGACGCCGCTCATCGGCCACGCGGCGCGGCTGCGTCTCGCG
ACGGGCGCGGGCGAGCGCAGCTGGAACGGCTATGTGACGCATGCGGCGTATGCGGACAGCGACGGCGAGA
TCACCCGCTATCGCCTCACGATGGAGTCGTGGCTCGCGCTGTTGCGCCTGCGTCGCAATTGCCTGTACTT
CGTCGACGTCGACACGAAGGACATCTGCGAGCGCGTGTTCGGCGATTATCCGCAAGCGCGTTGGCGCTAC
GAACTGAAGGAACCGCTGCGCAAGTTCAGCCTGCGCGGCCAGTACCGGGAGACCGACGACACGTTCGTGC
TGCGCCAGCTCGCCGAAGCCGGCCTGTCGTTCAGGATCGAGCATGCGCAGGATGCGGGCAAGGAAGCGTC
GGGCGACCATACGGTCGTCGTGTTCGATCGGCGCGCGCCATTTCGGCACGGCAGCACGATCGCATACAAC
CTGCAGGACGTCGGCGATCCGGACGGCGTGATCACGCAGTTTTCCGAACGCCATCAGATGGTGCCGGACC
GGGTCGTCGCGACGAGCTGGAAAGCCGACGAATTGCTCGCGCTCGCCGGGCACGCGCAGCAGCCGCCCGA
GGACAAGGCGCCGGTGCTGCCCGTGCGCGAAATCTACGACGGCCAACGCGCGGGCCGCTTCGACACGATC
GACGACGCGCAGCGCTTCGCCGAGCAGCGGCTCGACGCGCTGCGCCTGCCGAAGCGGATCCATTACGGCG
CGGGCTCGTCGCGCACGCTCGAGATCGGCGCGGTCCATACGCTCGCCGGTTATCTGGACCGTGCGATCAC
GTTCGTGCCGCTGTCGATCGAGCACGAGGCGGTCAACAATCTCGGCGCCGACATCGGCGCGCTGCTCGGG
CGCGGCGAGCTCGACAAGGGGCTGTACCGCAACCGTTTCGTCGCGGTGCCCGACGGCACGCCGATCGTGC
CGCCGCATCGCGATCGGCCGATCGTGCACGGCGTGCAGACCGCGATCGTCGTCGGCGAGGCCGGCAGCCG
CGTCAGCAGCACGCGCGATCATCAGGTGCGCGTGCAGTTTCCGTGGATGCGCGGCACGGCGCCGCTGCCC
GGCGGCCTGACCGACACGGCGAGCCGCTCGAATCCGGCCGGGCACGCGCCGGGCGATCATCGCTCGGGCG
TGCTCGCGCGCGTCGCGGAATCATCGGCCGGGCCGAACTTCGGGCATGCGTTCACGCCGCGCGTCGGCGC
CGAAGTGGTGATCGGCTTCGAGTCGGGCAACATCGACATGCCCGTCGTGCTCGGCCAGGTCTACGGCGGG
CGCGTGCAGCCGCCGTTCGCGGCGGGCGAAGGCAGCGACGCGAACCATCCGGGCACGCTGACCGGCCTGC
AGACGCAAACGCTCGATGGCCAGTCCGGCAGCCGCTGGGTGATGGACGACGCCGCGGGACAACTGCGGCA
CGAGCTGAGCAACTCGACCGCGAACAGCCGGCTCGCGCAGGGTTACCTGATCGATCAGCAGGGCGCGATG
CGCGGCGCGTATCGCGGCGAAGGCTTCGAGCTCGCGACCGACGGATGGGGCGTCGTGCGCGCGGGCGAAG
GCGTGCTCGTATCGAGCACGGCGCGGCGGCTCGCGACGTCGACGCAGATGGACGTCGCGCAAAGCGTCGG
ACAACTGAAGCAGGCGGTGCGGACCGCGCAGGGCATGAGCGAATCCGCCGCCGCGGCGCACGCGGGCGGG
TTGGCCGCCAATGCCGCGCAGGCGGATTTCCTGAAGGCGATCGATCCGGCGCAGGACGGCAAGTACACGG
GCGCGGTCAACGGGCAGAGCGCGACGAAGGCGAGCGGCGCGCAGCGCGACGGCGGGGAGCCGGTCGAGCG
CTTCGCCGCGCCGGCCGTGCTAATGGAGTCGCCGGAGAACATCGTGCTGACGACGCCGCACAGCGCCGTC
TCGTATGCGGCGCAGCACGTGCATTTGACCGCGCAGCGCGACGCGCACGTAGCGGCCGCCGCGACGGTCG
CGGCCGCGTCGGGCGATGCCGTGAGCCTGTATGCCGCCGCGGGCGGCCTCCGGGCGATCGCGAGCGACGG
GCCGGTGAGCGTCGAGGCGCATACGTCGACGATGGAGATTCTCGCGGATCAGTCGGTGCGCATCACGTCG
ACCGACGATCGCATCGACGTGCTCGCGAAGGACGCGATCGTGCTGCAGCAGGGGCCGAACCGGATCACGC
TGAAGGGCGGCGACATCACGGTCGAGACGCCGGGGCAGTTCCTCGTGAAGTCGGGCGCGCATCCGTTTCC
GGGGCCGGCCGCGCAGAGCGTTTCACTGCCGCCGCTGCCGATTCCCGCGCCGCTCGCGCTGTTCGACGAA
CAGATTCGCTTCGTCAACGAAGACGGCGAGCCGCTCGGCAACGTCGCGTACCAGTTGAAGCTCGCCGATG
GCTCGACCGTGTCGGGCGTGACCGACGACAACGGCAGAACCGAGCGCGTATCGACGGACGGGCCGACGGC
GATCCAGTCGGCGACGCTCACGCCGACGCAGGTCGTCGACTGCTGCGGGCGAACCTCGGATGTGCCGCCG
CCGGCGGTGAAGGTCGACATCAAGGGCGTCGGCACCCACGACACGCTGGTGGGCAGCTCGGAGCAATCGG
TCACGGTCAAGGGCGAGAGCCGGCCGCTGACCGACGGTGAGATCGAGATGGCGAAAACCGTGTTTCAGGA
CAGCATCGATTACAGCGCGGTGCGCGTGCACAAGGGCAGCTATTTCTGGTTCAACTTGCAGAGCAAGCGT
ACGGCCGTGACGCCGAACAATACGATGTATTTCCGCGAAGAGGATTTCGTGGAGGATTTTTCGGTTGTCA
GCGAGGAGTATCCGAGGCGGGGTTGGTTCATGCACGAAATGACGCACGTTTGGCAACATCAACGAGGATA
TGCCGTGCGCTGGCATGCGCTTACCGTGACGATTCGCGGCGAGAGCGCGTATCGGTACGAAATCGAGCCC
GGGCAAGTCTTCAGCGATTTCAATATGGAGCAGCAAGGCAATCTTGTATCAGACTACTTTGCGCTCATTG
TCGTGGACAATCGAGGTGAGTTGATTCATGCGCAACCAGGAAGCAAGAATCAACTTCGCCAAGTGCTGGC
TCCACTTCTACAGGATCCCAAGGATGCATCGAATCTTCCGAAATAG