SecReT6
Effector Protein ID: 557224087
-
SecReT6 ID869
T6SS typeA1
Gene symbol-
Locus tagPVLB_16970
StrainPseudomonas sp. VLB120
Repliconchromosome [GenBank: NC_022738] [Browse all T6SS(s) in this replicon]
Location [Strand]3757341..3757859 [-]
Producthemolysin co-regulated protein 1C
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDU5VKD6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-40, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|557224087|ref|YP_008764302.1| hemolysin co-regulated protein 1C [Pseudomonas sp. VLB120]
MATPAYMSVTGEKQGLITAGAFTADSVGNTYQEGHEDQVMVQGFDHQVIIPRDPQSGQPTGQRVHKPVKI
TKVFDKASPLLLAALTSGERMTKVEIKWYRTSAAGTQEHYYTTVLEDAIIVDMKDYMHNCQDPANAHFTH
LEDVYFTYRKITWTHEVSGTSGSDDWRVPVAG
-
Nucleotide Sequence: 519 bp     [Download]
>gi|557220722|ref|NC_022738.1|:c3757859-3757341 Pseudomonas sp. VLB120, complete genome
ATGGCAACACCCGCGTACATGTCCGTCACCGGCGAAAAACAAGGCCTGATCACCGCTGGCGCGTTCACCG
CCGATTCGGTGGGCAACACCTACCAGGAAGGCCACGAAGACCAGGTGATGGTCCAGGGCTTCGACCACCA
GGTGATCATCCCCCGTGATCCGCAGTCCGGCCAACCGACCGGCCAGCGCGTGCACAAACCGGTGAAGATC
ACCAAGGTCTTCGACAAGGCCTCGCCACTGCTGCTGGCGGCCCTGACCTCCGGCGAGCGCATGACCAAGG
TCGAGATCAAGTGGTACCGCACCTCGGCCGCCGGCACCCAGGAGCACTACTACACCACCGTCCTGGAAGA
CGCGATCATCGTCGACATGAAGGACTACATGCACAACTGCCAGGACCCGGCCAACGCCCACTTCACCCAC
CTGGAAGACGTGTACTTCACCTACCGCAAGATCACCTGGACCCACGAGGTCTCCGGGACTTCCGGTTCCG
ACGACTGGCGCGTTCCGGTCGCAGGCTAA