SecReT6
Effector Protein ID: 557224893
-
SecReT6 ID869
T6SS typeA1
Gene symbol-
Locus tagPVLB_21000
StrainPseudomonas sp. VLB120
Repliconchromosome [GenBank: NC_022738] [Browse all T6SS(s) in this replicon]
Location [Strand]4620093..4620611 [+]
Producthemolysin co-regulated protein 1C
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDU5VMQ1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.10E-40, Aligned region: 6..155
Protein Sequence: 172 a.a.     [Download]
>gi|557224893|ref|YP_008765108.1| hemolysin co-regulated protein 1C [Pseudomonas sp. VLB120]
MATPAYMSVTGEKQGLITERAFTVESVGNTYQEGHEDEVMVQAFDHQVIIPRDPQSGQPTGQRVHKPVKI
TKVFDKTSPQLLAALASGERMTKVEIKWYRTSAAGTQEHYYTTVLEDAIIVDIKDYMYNCQDEANAHFTH
LEDVSFTYRKISWTHLISGTSGSDDWRAPVTG
-
Nucleotide Sequence: 519 bp     [Download]
>gi|557220722|ref|NC_022738.1|:4620093-4620611 Pseudomonas sp. VLB120, complete genome
ATGGCAACACCCGCGTACATGTCCGTCACCGGCGAAAAACAAGGCCTGATCACCGAGCGCGCGTTCACCG
TCGAGTCGGTGGGCAACACCTACCAGGAAGGCCACGAGGACGAGGTGATGGTCCAGGCCTTCGACCACCA
GGTGATCATCCCCCGTGACCCGCAGTCCGGCCAACCGACCGGCCAGCGCGTGCACAAACCGGTGAAGATC
ACCAAGGTCTTCGACAAGACTTCGCCGCAGCTGCTGGCGGCCCTGGCCTCCGGCGAGCGCATGACCAAGG
TCGAGATCAAGTGGTACCGCACCTCGGCGGCCGGTACCCAGGAGCATTACTACACCACCGTCCTGGAAGA
CGCGATCATCGTCGACATCAAAGACTACATGTACAACTGCCAGGACGAAGCCAACGCCCACTTCACCCAC
CTGGAAGACGTGTCCTTTACCTACCGCAAGATCAGCTGGACCCACCTGATCTCCGGAACTTCTGGCTCCG
ACGACTGGCGCGCCCCGGTCACAGGCTAA