SecReT6
Effector Protein ID: 558672802
-
SecReT6 ID874
T6SS typeA3
Gene symbol-
Locus tagPA1S_gp0493
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]610883..612823 [-]
ProductVgrG protein
Effector typeProtein
Homologous effectorPA0091
Descriptiontype VI secretion system Vgr family protein
UniProt IDU6A9V5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.20E-89, Aligned region: 29..329
Phage_GPD [PF05954], Evalue: 7.20E-89, Aligned region: 346..396
Phage_base_V [PF04717], Evalue: 6.70E-26, Aligned region: 369..462
Protein Sequence: 646 a.a.     [Download]
>gi|558672802|ref|YP_008809510.1| VgrG protein [Pseudomonas aeruginosa PA1]
MLFSQHTRLVHVDSPLGPEVLQLQRLEGREELGRLFSHELELVSSNPALPLDALLGKPMSLALELPGGSR
RHFHGIVARCSQGAGAGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRS
YREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHEQSRHILVLSDAYGAHQSPPNYASVPYYPPTLEQRER
DHFYDWHMAREVQSGSLSLNDYDFQRPGARLEVRSNIARSHAAADYPLYDYPGEYVQSQDGEQYARTRIE
ALQARYERVRLRGRARGLGSGHLFKLSGYPREDQNREYLVVGAEYRVVQELYETGGGGVGAQFESELDCI
DAGQAYRPLPTTPLPIVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWMRVSQAWAGK
NWGSIQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGMKSRSSKGGTPANFNEIRM
EDKKGAEQLYIHAERNQDNLVENDASLSVGHDRNKSIGHDELARIGNNRTRAVKLNDTLLVGGAKSDSVT
GTYLIEAGAQIRLVCGKSVVEFNADGTINISGSAFNLYASGNGNIDTGGRLDLNSGGASEVDAKGKGVQG
TIDGQVQAMFPPPAKG
-
Nucleotide Sequence: 1941 bp     [Download]
>gi|558672313|ref|NC_022808.1|:c612823-610883 Pseudomonas aeruginosa PA1, complete genome
ATGCTGTTCTCCCAACATACCCGTCTGGTGCACGTGGACTCCCCGCTGGGGCCCGAGGTCCTGCAACTGC
AACGGCTGGAAGGCCGCGAGGAGCTGGGCCGGCTGTTCAGCCACGAGCTCGAACTGGTCTCGAGCAATCC
CGCCTTGCCTCTGGATGCCCTGTTGGGCAAGCCGATGAGCCTCGCGCTGGAACTCCCCGGCGGTAGCCGG
CGGCACTTCCACGGCATCGTCGCGCGCTGCAGCCAGGGCGCCGGCGCCGGCCAGTTCGCCAGCTACCAGG
TCACCCTGCGGCCCTGGCTGTGGCTGCTGACGCGCACTTCGGACTGCCGCATCTTCCAGAACCAGAAGGT
CCCGGACATCATCAAGCAGGTGTTCCGCGACCTCGGCTTCTCCGACTTCGAGGACGCCCTGAGCCGCTCC
TACCGCGAGTGGGAATACTGCGTGCAGTACCGCGAGACCAGTTTCGACTTCGTCAGCCGGCTGATGGAGC
AGGAAGGCATCTACTACTGGTTCCGCCACGAGCAGAGCCGCCACATCCTGGTGCTCTCCGACGCCTACGG
CGCGCACCAGAGCCCGCCGAACTACGCCAGCGTGCCCTACTACCCGCCGACCCTGGAACAGCGCGAGCGC
GACCATTTCTACGACTGGCACATGGCGCGCGAGGTGCAGTCCGGTTCGCTGAGCCTCAACGACTACGACT
TCCAGCGTCCCGGCGCGCGCCTGGAGGTGCGTTCGAACATCGCCCGCTCGCACGCGGCGGCCGACTACCC
GCTGTACGACTACCCCGGCGAATACGTGCAGAGCCAGGACGGCGAGCAGTACGCGCGGACCCGTATCGAA
GCCTTGCAGGCGCGCTACGAACGGGTGCGCCTGCGCGGCCGCGCCCGCGGCCTGGGTTCGGGCCACCTGT
TCAAGCTCAGCGGCTACCCGCGCGAGGACCAGAACCGCGAGTACCTGGTGGTCGGCGCCGAGTACCGGGT
GGTCCAGGAACTCTACGAGACCGGCGGCGGCGGGGTCGGCGCGCAGTTCGAGAGCGAGCTGGACTGCATC
GATGCCGGCCAGGCCTACCGCCCCTTGCCGACCACTCCGCTGCCGATCGTCCGTGGCCCGCAGACTGCGG
TGGTGGTCGGGCCCAAGGGCGAGGAGATCTGGACCGACCAGTACGGCCGGGTCAAGGTGCATTTCCACTG
GGACCGCCACGACCAGTCCAACGAGAACAGCTCCTGCTGGATGCGCGTCTCCCAGGCCTGGGCGGGGAAG
AACTGGGGCTCGATCCAGATCCCGCGGATCGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCGG
ACCGGCCGATCATCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGC
CACCCAGAGCGGGATGAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATG
GAGGACAAGAAGGGCGCCGAGCAGTTATACATCCACGCCGAGCGCAACCAGGACAACCTGGTCGAGAACG
ATGCCTCGCTGTCGGTCGGCCACGACCGCAACAAGAGCATCGGCCACGACGAGCTGGCGCGCATCGGCAA
CAACCGCACCCGCGCGGTGAAGCTCAACGACACCCTGTTGGTGGGCGGGGCGAAGAGCGACAGCGTCACC
GGCACCTACCTGATCGAGGCCGGCGCGCAGATCCGCCTGGTCTGCGGCAAGAGCGTGGTGGAGTTCAACG
CCGACGGCACCATCAATATCTCCGGCAGCGCCTTCAACCTCTACGCCAGCGGCAACGGCAACATCGACAC
CGGCGGCCGCCTCGACCTCAATTCCGGCGGCGCCAGCGAGGTCGACGCCAAGGGCAAGGGCGTGCAGGGC
ACCATCGACGGCCAGGTACAGGCGATGTTTCCGCCGCCGGCGAAGGGCTGA