SecReT6
Effector Protein ID: 558672903
SecReT6 ID874
T6SS typeA3
Gene symbol-
Locus tagPA1S_gp0595
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]715106..715555 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2774
DescriptionTse4
UniProt IDU6A7W5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 149 a.a.     [Download]
>gi|558672903|ref|YP_008809611.1| hypothetical protein PA1S_gp0595 [Pseudomonas aeruginosa PA1]
MSFRYGGVGGGIGLGMRLPRFGKVNLNVKGKSVGGAGALEALPSTGTVLVADGLVGRDLSRGDFTGPCMY
VELGAGVIAGGSGTAILFGLDPKLLAAVALASASPLTAALGASMSRQLLQSSRGALLMAGVNVGAQFGGG
AAAYLGALF
-
Nucleotide Sequence: 450 bp     [Download]
>gi|558672313|ref|NC_022808.1|:c715555-715106 Pseudomonas aeruginosa PA1, complete genome
GTGTCCTTCCGCTATGGCGGGGTGGGCGGCGGGATCGGACTGGGCATGCGCCTGCCGCGCTTCGGCAAGG
TCAACCTCAATGTCAAGGGCAAGAGCGTTGGCGGGGCCGGTGCGCTGGAGGCGTTGCCGAGCACCGGAAC
CGTCTTGGTCGCGGACGGCCTGGTGGGGCGCGACCTGTCCCGCGGCGACTTCACCGGGCCCTGCATGTAC
GTCGAACTCGGCGCGGGAGTCATCGCCGGCGGTTCGGGCACGGCGATCCTCTTCGGCCTCGATCCCAAGC
TGCTGGCGGCGGTGGCGCTGGCGAGCGCCTCGCCATTGACCGCCGCGCTGGGCGCCAGCATGTCGCGGCA
ATTACTGCAATCGTCCCGTGGCGCCCTGTTGATGGCCGGGGTCAACGTCGGTGCACAGTTCGGCGGCGGC
GCGGCGGCTTACCTGGGGGCGTTGTTCTGA