SecReT6
Effector Protein ID: 558675462
-
SecReT6 ID875
T6SS typeA1
Gene symbol-
Locus tagPA1S_gp3202
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]3580494..3581120 [-]
ProductSecreted protein Hcp
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDU6AHF5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.80E-20, Aligned region: 6..93
Protein Sequence: 208 a.a.     [Download]
>gi|558675462|ref|YP_008812170.1| Secreted protein Hcp [Pseudomonas aeruginosa PA1]
MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFNHEVIIPRDPQSGQPTGQRVHKPVVI
TKVFDKASPLLLAALTSGERLTKGDPVVPHLRRRHPGALLHHRPGRRDHRRHQGLHAQLPGPGQRPLHPP
GRRALHLPQDHLDPRSLRHLRLRRLALPGRRLSRGRRTRPASLAVVPSMTHSAVARKARAGSMPLCLL
-
Nucleotide Sequence: 627 bp     [Download]
>gi|558672313|ref|NC_022808.1|:c3581120-3580494 Pseudomonas aeruginosa PA1, complete genome
ATGGCAACACCCGCCTATATGTCCATCACCGGCACCAAGCAGGGCCTGATCACCGCCGGCGCCTTCACCG
AGGATTCGGTCGGCAACACCTACCAGGAAGGCCACGAGGACCAGGTGATGGTCCAGGGCTTCAACCACGA
AGTGATCATCCCGCGCGACCCGCAGTCCGGCCAGCCGACCGGCCAGCGCGTGCACAAGCCGGTGGTCATC
ACCAAGGTCTTCGACAAGGCCTCGCCGCTGCTGCTGGCCGCCCTGACCTCCGGCGAGCGCCTGACCAAGG
GAGATCCAGTGGTACCGCACCTCCGCCGCCGGCACCCAGGAGCACTACTACACCACCGTCCTGGAAGACG
CGATCATCGTCGACATCAAGGACTACATGCACAACTGCCAGGACCCGGGCAACGCCCACTTCACCCACCT
GGAAGACGTGCACTTCACCTACCGCAAGATCACCTGGACCCACGAAGTCTCCGGCACCTCCGGCTCCGAC
GACTGGCGCTCCCCGGTCGCCGGCTGAGCCGCGGCCGCCGCACGCGGCCAGCCTCGCTGGCCGTCGTGCC
CTCGATGACCCATAGCGCCGTGGCCAGGAAAGCCCGCGCCGGGTCGATGCCGCTTTGTTTGTTGTAG