SecReT6
Effector Protein ID: 560172929
-
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_1083
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]1147856..1148536 [+]
Productputative chitin-binding protein
Effector typeProtein
Homologous effectorSMDB11_1083 (Tfe2)
DescriptionTfe2 intoxication leads to extensive Tfe2 intoxication leads to extensive nutrient imbalance, interference with plasma membrane transporters and induction of autophagy
UniProt IDsmac:SMDB11_1083
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 226 a.a.     [Download]
>gi|560172929|ref|CDG11658.1| putative chitin-binding protein [Serratia marcescens subsp. marcescens Db11]
MPLEVDGIIRGDRGSEPSRWQHASTKPLITLTWHHTIPWNCLRNVWNGLVAGQHWNALDEFMNLIGVPNR
AEVITQIKNKNLQDRDGLHTLVTWQGWNIVEGPGNEYRAQGDDPGENFDGWSGKGMSTNQQATLQQVNVL
YQVMAPLGSRALDAARQAPNISAEEASVLQRTIKQTRPTLRGKEPIRWQEDMWHQVQPGKEAKHFARWDT
KPVWRKRLHSDLAQAG
-
Nucleotide Sequence: 681 bp     [Download]
>gi|560171871|ref|HG326223.1|:1147856-1148536 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGCCATTAGAAGTCGATGGGATCATTAGAGGCGATCGGGGCAGTGAACCGAGCCGTTGGCAACATGCGT
CAACCAAACCGCTTATCACGCTGACCTGGCATCACACCATTCCTTGGAACTGTTTGCGTAATGTCTGGAA
TGGTCTGGTGGCGGGGCAGCATTGGAACGCGCTGGACGAGTTTATGAACCTGATCGGTGTGCCAAACCGT
GCCGAGGTGATCACACAGATCAAGAATAAAAACCTGCAGGATCGCGATGGATTACACACTCTGGTGACCT
GGCAAGGATGGAACATCGTCGAGGGGCCTGGTAATGAGTATCGTGCGCAGGGGGACGATCCCGGTGAAAA
CTTCGACGGTTGGTCGGGTAAGGGGATGAGCACTAATCAGCAAGCGACGCTGCAGCAGGTCAACGTGTTG
TATCAGGTGATGGCGCCGCTGGGAAGCCGTGCGCTGGACGCCGCCAGACAGGCGCCGAACATTTCTGCGG
AAGAAGCGAGCGTCTTGCAACGGACGATTAAACAGACCCGTCCAACGTTGCGAGGAAAGGAACCGATCCG
GTGGCAAGAAGACATGTGGCATCAGGTGCAGCCGGGTAAAGAGGCGAAACACTTCGCCCGTTGGGACACC
AAACCGGTGTGGCGCAAGCGCCTGCACAGCGATCTGGCTCAGGCTGGATAA

Reference
(1) Katharina Trunk, Julien Peltier, Yi-Chia Liu, Brian D Dill, Louise Walker, Neil A R Gow, Michael J R Stark, Janet Quinn, Henrik Strahl, Matthias Trost, Sarah J Coulthurst (2018). The Type VI Secretion System Deploys Antifungal Effectors Against Microbial Competitors. Nat Microbiol. 3(8):920-931. [PudMed:30038307] experimental
 
experimental experimental literature