SecReT6
Effector Protein ID: 560172958
-
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_1112
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]1178412..1178963 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSMDB11_1112 (Ssp3)
DescriptionSMA1112 (Ssp3)
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 183 a.a.     [Download]
>gi|560172958|ref|CDG11688.1| hypothetical protein [Serratia marcescens subsp. marcescens Db11]
MHWLNFKRYKSDVAKQAVPPHLNAAEFARHYADKPQTDTEEYLSLSGEMCWDAVVLCAHRSGALSKAKYK
QLWQTVFDKQYKHFVSPDDTEIRTMADMLRAPQGCFIGIFSLRDAAAPRLLHAMIGTGAGFAAGNKNLCI
GVGGAVGWENLNLARDLRWQPEGGFLRQGDNEVLRIFYRPFPA
-
Nucleotide Sequence: 552 bp     [Download]
>gi|560171871|ref|HG326223.1|:1178412-1178963 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGCATTGGTTGAATTTCAAGCGCTACAAGAGTGACGTTGCCAAACAGGCCGTGCCGCCGCATTTGAATG
CGGCCGAATTTGCACGGCATTACGCCGATAAGCCGCAAACCGATACGGAAGAGTATCTTTCGCTCAGCGG
GGAGATGTGCTGGGATGCGGTGGTGCTTTGTGCCCACCGTTCTGGCGCGCTCAGCAAGGCGAAATACAAG
CAGTTGTGGCAGACGGTGTTCGATAAGCAATACAAACATTTCGTTAGCCCGGATGATACCGAGATCCGCA
CTATGGCCGATATGCTGCGCGCGCCGCAGGGATGTTTTATCGGCATATTCTCCCTGCGCGACGCGGCTGC
GCCCCGTTTGCTGCATGCCATGATCGGTACCGGTGCGGGATTTGCCGCAGGCAATAAAAATCTTTGCATC
GGCGTGGGGGGCGCGGTCGGCTGGGAAAATCTCAATCTGGCGCGCGATCTGCGCTGGCAGCCGGAAGGCG
GTTTTTTACGCCAGGGTGATAACGAAGTGCTGCGCATTTTTTATCGGCCTTTCCCCGCCTGA