SecReT6
Effector Protein ID: 560173453
-
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_1610
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]1689650..1693942 [+]
ProductRhs-family protein
Effector typeProtein
Homologous effectorSMDB11_1610(Rhs2)
DescriptionThe Rhs2 C-terminal domain is a DNase toxin and exhibits DNase activity.
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 2.2e-05, Aligned region: 401..441
RHS_repeat [PF05593], Evalue: 1.4e-06, Aligned region: 553..591
RHS_repeat [PF05593], Evalue: 2.3e-11, Aligned region: 640..676
RHS_repeat [PF05593], Evalue: 6.2e-09, Aligned region: 661..698
RHS_repeat [PF05593], Evalue: 7.6e-06, Aligned region: 703..736
PAAR_motif [PF05488], Evalue: 6.5e-17, Aligned region: 86..155
RHS [PF03527], Evalue: 1.0e-12, Aligned region: 1178..1214
Protein Sequence: 1430 a.a.     [Download]
>gi|560173453|ref|CDG12184.1| Rhs-family protein [Serratia marcescens subsp. marcescens Db11]
MTEAARVGDTIGHSHALAGMIAGTLVGGLIAAAGALAAGALFVAGLAASCIGVGVLLIGASLAVGYLTGE
AATAARDGIADAGAGSLTPKGNIVTGSPNVFINGKPAALATNSQVACSDDGPSMQMAQGSDKVSINGQPA
SRVGDKTNCDAQVMEGSPNVFIGGGTVTTLPIKPEVPDWLYKVSDLTLLFAGLVGGVGGAAGKLGALGKL
LGKLPGINKLARIACRAGTLMTATAAVGIIARPVDIVSGQKFLDGEDDLDFVLPSRLPVAWQRYWRSGNP
GDSVLGRGWNLFWESSLQPYQDGLVWRAPSGDFVAFPMVPRGHKTYCEAEKCWLMHNDDGSWQLFDVGEQ
IFHYPPLAGEQPSRLSMITDAIGNATSLFYDDEGLLSELVDSAGQRLMCRYAQGRLREVALQTAEGERTL
ARYGYDEQGQLTTVSNRAGEVTRRFGWRDGLMISHQDAAGLLNEYQWQEIDGVPRVTAYRNSAGESLEFG
YDFAGGRRSAVRGDGKRAEWRLDDDDNVAQYTDFDQRRYGFIYQRGELCSVLLPGGAQRQSEWDPYGRLL
SETDPLGRVTRYQYSRNSGRLFAVAYPDGSSEAQHWDTLGRPTRYVDALGNTTLYRYPDDEESLPASVID
ALGGEVKLEWDARGQLTRYTDCSGSVTAYTYDALGQLTAQTDAEGHQTRYRWDNGGRLHTLIHPDGGEER
FNWNAHGQLAEHQDALGSLTRWQYNALGLPVSITDRINRTRRYHYSPQGWLTRLENGNGGDYRFSYDAVG
RVVAEERPDDTRHYYRYGAAGLLEEHREVGLPGGAGELTQREQRFRFDEAGQLVWRSNASAEWHYRFDAM
GRLRELNRLPTASGVALGIEPDSVQMRYDAAGRLLGEQGVNGELQYQWDALANLQALTLPQGDRLQWLYY
GSGHASAIKFNQQVVSEFTRDRLHRETGRSQGALQQQRRYDAMGRRSWQSSAFGHDKLTRPEDGVLWRAY
RYTGRGELAGVSDALRGEVHYGYDAEGRLLQHREPNQGKPGARLVYDLADNLLGERSPQSDIDAHLPLAP
IADNRLTHWQKLFYRYDAWGNLISRRNGLYEQHYRYDADNRLVQAHGRGPQGEFEAQYHYDALGRRSRKT
VHYKGKTEQTTHFLWQGYRLLQEQRDDGSRRSWSYDPASPWSPLAALEQAGDSRSADIYWYHTDLNSAPL
EVTDAAGNLCWSGQYDTFGKLQGQTVAGAAKRQGAQYQQPLRYAGQYQDDESGLHYNLFRYYEPEVGRFT
TQDPIGLEGGLNLYAYGPNPLTWIDPFGLSNCSTLDRIIGDANKVASRGGAITAKQAQILRDNLPVVQRR
SVFQNQMARKEFVRDQHYLMSQWEANTGRTWPTGATPHHIIPLESGGANKWWNLMPTHGTLPNHSLPGVP
GPHAAGGVLRTTVQQSRKALPPGTITDLRL
-
Nucleotide Sequence: 4293 bp     [Download]
>gi|560171871|ref|HG326223.1|:1689650-1693942 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGACCGAAGCGGCCCGCGTCGGCGATACCATCGGGCATTCCCATGCCCTGGCCGGCATGATTGCCGGCA
CCCTTGTCGGCGGCCTGATCGCCGCCGCAGGCGCACTGGCGGCGGGTGCGCTGTTCGTCGCCGGCCTGGC
GGCTTCCTGTATCGGCGTCGGCGTGCTGCTTATCGGCGCCAGCCTGGCGGTGGGGTATCTCACCGGGGAG
GCGGCCACCGCGGCGCGCGACGGCATTGCCGACGCCGGTGCCGGTAGCTTGACCCCCAAAGGCAATATCG
TCACCGGCTCCCCCAACGTCTTCATCAACGGCAAACCCGCCGCGCTCGCCACCAACAGCCAGGTGGCCTG
CAGCGACGACGGCCCGAGCATGCAGATGGCGCAGGGCTCCGACAAGGTCAGCATCAACGGCCAGCCCGCC
TCGCGTGTGGGGGACAAAACCAACTGCGACGCGCAGGTGATGGAAGGTTCGCCCAACGTGTTTATCGGCG
GCGGCACCGTCACCACCTTGCCGATCAAGCCCGAAGTGCCGGATTGGCTGTATAAGGTCTCCGATCTGAC
GCTGCTGTTCGCCGGCCTGGTGGGCGGCGTGGGCGGCGCCGCCGGCAAGCTGGGGGCGCTCGGCAAACTG
CTGGGCAAGCTGCCCGGCATCAACAAACTGGCGCGCATCGCCTGCCGTGCCGGCACCCTGATGACCGCGA
CCGCCGCGGTTGGCATTATCGCCCGGCCGGTGGATATCGTCAGCGGCCAGAAATTCCTCGACGGCGAAGA
CGATCTCGATTTCGTGCTGCCATCGCGCCTGCCGGTCGCCTGGCAGCGCTATTGGCGCAGCGGCAACCCC
GGCGACAGCGTACTGGGCCGCGGCTGGAACCTGTTCTGGGAGAGCAGCCTGCAGCCGTATCAGGACGGCC
TGGTGTGGCGCGCGCCTTCCGGCGACTTCGTCGCTTTCCCCATGGTGCCGCGCGGTCACAAAACTTACTG
CGAAGCCGAAAAATGCTGGCTGATGCACAACGACGACGGCAGTTGGCAGCTGTTTGACGTCGGCGAACAG
ATTTTCCACTACCCGCCGCTGGCGGGCGAGCAGCCGAGCCGGCTCAGCATGATCACCGACGCCATCGGCA
ACGCCACCTCGCTGTTTTACGACGACGAGGGGCTGCTGAGCGAACTGGTGGACAGCGCCGGGCAGCGCCT
GATGTGCCGCTATGCGCAGGGCCGCCTGCGCGAAGTGGCGCTGCAAACCGCCGAAGGCGAACGAACGCTG
GCGCGCTACGGTTATGATGAGCAGGGCCAACTGACGACGGTGAGCAACCGCGCCGGTGAGGTGACGCGCC
GCTTTGGCTGGCGCGACGGCCTGATGATCAGCCACCAGGACGCCGCCGGGCTGCTGAACGAATACCAATG
GCAAGAGATCGACGGCGTGCCGCGCGTGACGGCCTATCGCAACAGCGCCGGAGAATCCCTTGAGTTCGGC
TATGACTTCGCCGGCGGGCGCCGCAGCGCGGTGCGCGGCGACGGCAAGCGCGCGGAGTGGCGGCTGGATG
ACGACGACAACGTGGCGCAGTACACCGATTTCGACCAGCGCCGCTACGGTTTTATCTACCAACGCGGCGA
GCTGTGCAGCGTGCTGCTGCCCGGCGGCGCGCAGCGCCAGAGCGAATGGGACCCTTACGGCCGCCTGTTG
TCGGAGACCGACCCGCTCGGCCGCGTGACGCGCTATCAATATTCGCGCAACAGCGGCCGGCTGTTCGCCG
TCGCGTACCCGGACGGCAGCAGCGAGGCGCAGCACTGGGACACGCTGGGGCGCCCGACGCGTTATGTCGA
TGCGCTGGGCAATACCACGCTGTACCGCTATCCGGATGACGAAGAGAGCCTGCCGGCTAGTGTGATCGAC
GCGCTGGGCGGGGAAGTGAAGCTGGAGTGGGACGCCCGCGGCCAGCTGACGCGCTACACCGACTGTTCCG
GCAGCGTCACGGCTTATACCTACGATGCGCTGGGGCAACTGACGGCGCAGACCGATGCCGAAGGCCACCA
GACGCGCTACCGGTGGGATAACGGCGGGCGCCTGCACACCCTGATCCACCCGGACGGCGGCGAAGAGCGT
TTTAACTGGAATGCGCACGGCCAGCTGGCCGAACATCAGGACGCGCTGGGCAGCCTGACCCGCTGGCAGT
ACAACGCCCTGGGGCTGCCGGTCAGCATCACCGATCGCATCAACCGCACCCGGCGCTATCACTACAGCCC
GCAGGGCTGGCTGACGCGGCTGGAGAACGGCAACGGCGGCGACTACCGCTTCAGCTACGATGCGGTGGGC
CGTGTGGTGGCCGAAGAGCGCCCGGACGACACCCGCCACTATTATCGTTACGGCGCGGCCGGGCTGCTGG
AAGAGCACCGTGAGGTCGGCCTGCCGGGCGGCGCGGGCGAGCTGACGCAGCGCGAACAGCGCTTCCGCTT
CGACGAGGCCGGGCAGCTGGTCTGGCGCAGTAACGCCAGTGCGGAATGGCATTACCGTTTCGACGCCATG
GGGCGGCTGCGTGAGCTGAACCGCCTGCCGACGGCGAGCGGCGTGGCGCTGGGCATCGAGCCGGACAGCG
TGCAGATGCGCTATGACGCCGCCGGGCGGCTGCTCGGCGAGCAAGGCGTCAACGGCGAGCTGCAATACCA
ATGGGATGCATTGGCCAACCTGCAGGCGCTGACGCTGCCGCAGGGCGATCGCCTGCAGTGGCTGTATTAC
GGCTCCGGCCACGCCAGCGCCATCAAATTCAACCAGCAGGTGGTGAGCGAGTTCACCCGCGATCGCCTGC
ACCGGGAAACCGGCCGCAGTCAGGGCGCGCTGCAGCAGCAGCGGCGTTACGACGCCATGGGCCGCCGCAG
CTGGCAGAGCAGCGCCTTCGGCCACGACAAACTGACCCGGCCGGAAGACGGCGTGCTGTGGCGCGCTTAT
CGCTACACCGGCCGCGGCGAGCTGGCCGGGGTGAGCGACGCGCTGCGCGGCGAAGTGCACTACGGTTACG
ACGCCGAGGGCCGCCTGCTGCAACACCGCGAACCCAATCAGGGCAAACCGGGCGCGCGGCTGGTGTACGA
CCTGGCGGATAACCTGCTGGGCGAGCGCAGCCCGCAGAGCGATATCGACGCGCACCTGCCGCTGGCGCCG
ATCGCCGACAACCGCCTGACGCACTGGCAAAAACTGTTTTACCGTTACGATGCCTGGGGCAACCTGATCA
GCCGGCGCAACGGTCTGTACGAACAGCACTACCGCTACGACGCCGACAACCGGCTGGTGCAGGCGCACGG
CCGCGGCCCGCAGGGCGAGTTCGAGGCGCAGTACCATTACGACGCGCTGGGACGCCGCAGCCGCAAAACG
GTGCACTACAAGGGCAAAACCGAACAGACGACCCATTTCCTGTGGCAGGGTTATCGGTTGCTGCAGGAGC
AGCGCGACGACGGCAGCCGCCGCAGCTGGAGCTACGATCCGGCCAGCCCGTGGAGCCCGTTGGCGGCGCT
GGAGCAGGCAGGCGACAGCCGCTCGGCGGATATTTACTGGTATCACACCGATCTGAACAGCGCGCCGCTG
GAGGTGACCGACGCGGCGGGCAACCTGTGCTGGTCCGGGCAATACGACACCTTCGGCAAGCTGCAGGGCC
AGACGGTGGCCGGCGCGGCGAAGCGGCAGGGCGCGCAATACCAGCAGCCGCTGCGCTACGCCGGGCAATA
CCAGGATGACGAAAGTGGCCTGCACTACAACCTGTTCCGCTACTACGAACCCGAGGTGGGGCGTTTCACC
ACGCAGGATCCGATAGGGTTGGAAGGCGGGCTGAATTTATATGCTTATGGGCCAAATCCTTTAACTTGGA
TAGATCCATTTGGGTTAAGTAATTGTTCGACTCTTGACCGTATTATTGGTGATGCGAACAAAGTCGCTTC
GCGTGGTGGAGCTATAACAGCAAAACAAGCTCAGATACTGAGAGATAATTTACCGGTAGTTCAGAGACGG
AGTGTTTTCCAAAATCAGATGGCTCGCAAAGAGTTCGTCAGAGATCAGCATTATCTGATGAGTCAGTGGG
AAGCCAATACAGGTAGAACCTGGCCGACAGGAGCTACCCCGCACCACATAATCCCACTAGAAAGTGGGGG
GGCGAATAAATGGTGGAATTTGATGCCTACTCATGGCACTTTGCCTAATCATTCTTTACCTGGTGTACCT
GGCCCACATGCCGCCGGTGGAGTGCTTCGAACAACTGTTCAACAAAGCAGAAAAGCACTGCCTCCTGGAA
CTATAACTGATTTGAGATTGTGA

Reference
(1) Francesca R Cianfanelli, Juliana Alcoforado Diniz, Manman Guo, Virginia De Cesare, Matthias Trost, Sarah J Coulthurst (2016). VgrG and PAAR Proteins Define Distinct Versions of a Functional Type VI Secretion System. PLoS Pathog. 12(6):e1005735. [PudMed:27352036] experimental
(2) Diniz JA et al. (2015). Intra-species Competition in Serratia marcescens is Mediated by Type VI Secretion Rhs Effectors and a Conserved Effector-Associated Accessory Protein. J Bacteriol. pii: JB.00199-15. [PudMed:25939831] experimental
 
experimental experimental literature