SecReT6
Effector Protein ID: 560174104
-
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_2261
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]2385090..2385581 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSMDB11_2261 (Ssp1)
DescriptionSMA2261 (Ssp1)
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Tae4 [PF14113], Evalue: 2.9e-20, Aligned region: 46..160
Protein Sequence: 163 a.a.     [Download]
>gi|560174104|ref|CDG12836.1| hypothetical protein [Serratia marcescens subsp. marcescens Db11]
MKPLYRQLKSSHYSSDYSSPGYLAAEAVYAEIGYELDTLLKQNPGYANTCAVRMSLALLKTGISFKGRLP
IKKGAYKGKTIEPGAKLLADQLHRSSSFGKAKIFFNAPDAEKGIGNKKGVVFFNKITNYDGGHIDLIEPE
NSLLTCHSHCYFNCKEVWFWELS
-
Nucleotide Sequence: 492 bp     [Download]
>gi|560171871|ref|HG326223.1|:2385090-2385581 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGAAACCTTTATATCGTCAGCTAAAAAGCAGCCATTACTCCTCTGATTACTCTAGCCCGGGATATTTGG
CAGCAGAAGCCGTTTACGCTGAGATTGGCTATGAGCTTGATACGCTTCTAAAGCAAAATCCTGGTTATGC
CAATACCTGTGCCGTCCGCATGAGCCTGGCGCTGTTGAAAACCGGTATCAGCTTCAAAGGCCGCCTGCCA
ATCAAGAAAGGCGCCTATAAGGGTAAAACGATTGAACCGGGAGCCAAATTGCTGGCCGATCAGTTGCATC
GCTCCAGTAGTTTTGGCAAAGCCAAAATTTTCTTTAATGCTCCAGATGCAGAGAAAGGTATTGGCAATAA
AAAAGGAGTCGTGTTCTTCAATAAGATCACCAACTATGATGGCGGACACATTGATCTTATCGAACCAGAA
AACTCGCTATTAACCTGCCATTCCCATTGCTATTTTAACTGCAAAGAGGTCTGGTTTTGGGAGTTGAGCT
AG