SecReT6
Effector Protein ID: 560174107
-
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_2264
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]2386769..2387245 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSMDB11_2264 (ssp2)
DescriptionSMA2264 (ssp2)
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Tae4 [PF14113], Evalue: 3.3e-24, Aligned region: 46..155
Protein Sequence: 158 a.a.     [Download]
>gi|560174107|ref|CDG12839.1| hypothetical protein [Serratia marcescens subsp. marcescens Db11]
MSRPSFQQAWQRFSEINVDITDVGKKIGGNVGLNIELGVNDPLQGFTNACAIRMSYTLNYSGFKVERGAW
KTVSGKDKNWYIYRVRDIINFLNYKFGKPDKTIKNPTPSDFSKDKGILVFTVPGWNDASGHATLWNGTTC
SDHCYFPKSNEASIWLLK
-
Nucleotide Sequence: 477 bp     [Download]
>gi|560171871|ref|HG326223.1|:2386769-2387245 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGAGTCGCCCTTCATTCCAACAAGCGTGGCAACGATTTAGCGAAATCAACGTAGATATTACTGACGTTG
GCAAAAAGATAGGTGGAAATGTAGGTCTTAACATTGAGCTTGGCGTCAATGACCCATTGCAAGGATTCAC
CAATGCCTGCGCAATACGCATGAGTTACACGCTCAATTATTCTGGTTTTAAAGTTGAACGAGGAGCATGG
AAGACCGTTTCAGGCAAAGATAAAAATTGGTACATTTATCGCGTCAGAGATATTATTAACTTTTTGAATT
ATAAGTTCGGCAAACCTGATAAAACGATTAAAAACCCTACCCCTAGTGATTTTTCAAAAGACAAAGGGAT
ATTGGTTTTCACTGTTCCAGGATGGAATGATGCCAGCGGACACGCAACATTATGGAACGGTACAACCTGC
TCAGATCATTGTTACTTTCCAAAATCCAACGAGGCATCTATATGGTTACTAAAATAA