SecReT6
Effector Protein ID: 560174121
-
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_2278
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]2403168..2407589 [+]
ProductRhs-family protein
Effector typeProtein
Homologous effectorSMDB11_2278(Rhs1)
DescriptionRhs1 represents a novel antibacterial toxin, active in the cytoplasm of target cells and neutralized by RhsI1
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 7.4e-09, Aligned region: 699..736
RHS_repeat [PF05593], Evalue: 4.0e-09, Aligned region: 720..759
RHS_repeat [PF05593], Evalue: 1.8e-07, Aligned region: 783..820
RHS_repeat [PF05593], Evalue: 9.7e-06, Aligned region: 923..959
PAAR_motif [PF05488], Evalue: 8.5e-08, Aligned region: 178..223
RHS [PF03527], Evalue: 6.4e-10, Aligned region: 1226..1263
Protein Sequence: 1473 a.a.     [Download]
>gi|560174121|ref|CDG12853.1| Rhs-family protein [Serratia marcescens subsp. marcescens Db11]
MAEIWAARKDDELIHTSALADIASAVAEVAVYAVATAAVSAAAAAAAPALAGVAVLGAAATAASGCVGAG
LIVGFATSLTGVGEHISNGCDAVANWLFPPSVSGVILTGSPNVFTNAKPAARAAGRLLTPAEIKALPAPQ
PPQSFWDYGAELLAAGGNILSQLWQPGVAGPSQPSQPLEEDKISCDKHPLPQYLAEGSSKVFINGQPAVR
SNDRSTCEAKVSTDVSKNVQIGGGTVVVRDIKSGKLPGIGLALTVLPLLLGNPAKLVKNLPCMIGGGLAA
AGVNALGEAIHAAFNPVHAATGAKVLNDEEDLDLLLPARFPLIWQRNYNSRNGYQGLFGHGWRTPFEIWV
DLNDRDGVIECCLHDETGRELRFPLPEVNQPSFSAGEGLMFRRGEEGQLLIADTDGSVWRLFVPLPQTPS
RLRLVSLSDEYDNALLLNYDERQRLSHIVDSAGTMTLRLEYGDPRFDDRVTALRHNDEPRVRYRYDGGGD
LHQVIDAGGLVTREFHYNAQHLLTRHQQAGGPSFAYRWAMFDDWRVVEHRDSAGGGCTIDYDLAAGLTTV
TEYDGLRHQHRWNAQRLIVEYTDERGEVWHYQWNDEDMLIATRDPLGHGWHFRYDEAGNLVEEEDPLGHI
RLTGWLPQRALPISVKEPNGATQHFYYDERHALIAEIDALGHTQRYLRDGYGQVVQAVDANGGISHFAYD
EHGQLLRARDCSGKQTLYKYTAQGWLSEVTDAAGERVHYRYDAAGRLTQLQRAEGWQETLSWNAQGQLDR
YQGADGRLTHYRYDAAGRLLATRNPLDGEVVRHYDARGRLTALRNENAESYLFHWTACNLLQEEIGLDGV
STRYRYDECRRVVERRFAANTSAAFSHYFSHDGAGQLVSKQTPDGETRYRYSPLGQLLHAASYRGNAWHD
EPTTAQSEVSFDYDLLGRVTREQGANGTLRYDYDPMGNRTQTTLPDGRTLRALYYGSGHLLQLALDEITL
SEFERDNLHRELSRTQGRLTSRVHYDRLGRKDRREIFNDNRQRPAPASSSRQWSYDYQNNLTREEHNANP
FSYQRYQYDATGRLLSRDGTRPDTERYRYDPASNLLDEGQFRQRHNRVLHYQGIDYRYDVFGRTVEKRKG
HYRWQYLYDADHRLCEVVRYSQHRSEAQQHVHFHYDPLGRRTQKRVWQQSQDLRQPAGKCQTTTFLWEGF
RLLQETRDGMPLTYVYADQGSYEPLARIDGHAPAQVFYFHTAPNGEPESLTDSDGTLRWQSHSSAWGRIK
YEENQQDLDYSQNLRLQGQYLDRETGLHYNLFRYYDPDIGRFTQHDPIGLAGGINLYQYAPNPLGWVDPW
GWKPRCAATKANDHNQAAFGRQWQGRGIYKGRDSWSNIMLKEGDIVYGGAPGQSGFYFNKATLDAAGGSR
AKLWESLQVLPHEKFGYRSKIQAYRVKRETIAGTGKAISQDPTRFGEGGGTQFFLSNYKTVLEPIDKPFE
IGL
-
Nucleotide Sequence: 4422 bp     [Download]
>gi|560171871|ref|HG326223.1|:2403168-2407589 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGCAACTAGATACTTATGACGGAACACTAGAACTCGCGGGAATAACGCTAGGTACAGCGACAACCCGAG
AAATGCTAATAAAAGGCTCCAGATTGTGGGAGGGTTGGCCAGAAAAGTCAGATGGTAGGACTACATCATA
CAGAACAATAATCAGTACAAAAAAAGAAAAAGCCGGCGATATATATATAATTGCCGACTTCTCCGGGGCC
TTCATTACAGATGCAGTGCTTTGCAGTTGGCGTTTTGCGCCTGAAAAACTCATGATGGGAATACAAAAAA
AAGTAGAAGGTGCTATTACCAAAAATCTTCGAACATGGTTTTATGAAAAAACTCATATACAACTTCCAGT
TAGTGGTTCATGGGGGCATATTGACGCTGCTTATGACCCACATAATTTAACGGGAACAATAGTGTGCAAC
TATCGCAGTGCATTTCATACTGAGGATGAATGGCGAAAATATTGCAAAAGGAATAACATAATTTATTAA

Reference
(1) Francesca R Cianfanelli, Juliana Alcoforado Diniz, Manman Guo, Virginia De Cesare, Matthias Trost, Sarah J Coulthurst (2016). VgrG and PAAR Proteins Define Distinct Versions of a Functional Type VI Secretion System. PLoS Pathog. 12(6):e1005735. [PudMed:27352036] experimental
(2) Diniz JA et al. (2015). Intra-species Competition in Serratia marcescens is Mediated by Type VI Secretion Rhs Effectors and a Conserved Effector-Associated Accessory Protein. J Bacteriol. pii: JB.00199-15. [PudMed:25939831] experimental
 
experimental experimental literature