SecReT6
Effector Protein ID: 560175282
-
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_3455
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]3668310..3668792 [+]
Producttype VI secretion system, effector protein Hcp-like
Effector typeProtein
Homologous effectorSMDB11_3455 (Hcp)
DescriptionSMA3455 (Hcp)
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS_HCP [PF05638], Evalue: 2.0e-35, Aligned region: 6..138
Protein Sequence: 160 a.a.     [Download]
>gi|560175282|ref|CDG14018.1| type VI secretion system, effector protein Hcp-like [Serratia marcescens subsp. marcescens Db11]
MAIDMYMKVEGMTGESQDSNHKGWTDVLSFNWGASQPGNMAVGGGGGSGKVNYQDLRIQALIDKSTPAIL
KYCSSGKHVAKIELSVCKAGGNQVEYSKIVLEDVLVTQTDFNGVGQNDAIVVDYAFQASKVTMSYWEQGS
SGTKGAESKSGWDIKQNKES
-
Nucleotide Sequence: 483 bp     [Download]
>gi|560171871|ref|HG326223.1|:3668310-3668792 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGGCCATTGATATGTATATGAAAGTTGAAGGAATGACGGGCGAGTCCCAAGACAGCAATCATAAAGGAT
GGACCGACGTACTTTCGTTTAACTGGGGCGCTTCACAGCCAGGAAATATGGCTGTTGGCGGCGGGGGTGG
CTCCGGAAAAGTGAATTATCAAGACCTCCGTATTCAAGCCCTTATCGACAAATCTACGCCCGCTATTCTC
AAATATTGTTCCAGTGGAAAACATGTCGCGAAAATCGAGCTTTCCGTATGCAAAGCGGGCGGCAACCAGG
TGGAGTATTCCAAAATCGTTCTCGAAGACGTTCTGGTGACGCAAACTGATTTTAACGGTGTAGGCCAAAA
TGATGCGATCGTGGTTGATTACGCCTTCCAGGCGTCAAAAGTCACCATGAGTTACTGGGAACAAGGCAGC
AGCGGCACTAAAGGCGCGGAAAGCAAATCTGGTTGGGATATCAAGCAGAATAAAGAGAGCTAA