SecReT6
Effector Protein ID: 560175802
-
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_3980
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]4242848..4243843 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorSMDB11_3980 (Ssp4)
DescriptionSMA3980 (Ssp4)
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 331 a.a.     [Download]
>gi|560175802|ref|CDG14538.1| hypothetical protein [Serratia marcescens subsp. marcescens Db11]
MKTAFSTPFGSPEDDLTNAEFARLLGNTGVQEFYRDINLQALQDSLDCSLAFHGVGIIFSDGQNSFLVRP
TQHTGYSNASQVTHVVISKTVAHTSRVAATNTLSEALSKPSVSKELASAALSCGTLLVSVFLLASGSVAV
PFTGGTSSAVAYLGYAGMAASALQCGNGLYRVNKLYDGKGDELAQLDSEQWYIATSTVLDVISLASAGAA
LKEATMTYRAMRRISARKATEWLKSMPRSERKRLTENIIRAENPGISNNVLKEMVKNGLYPKRYPTEAIQ
NGLRQQLHSALNNALTFVGSGISGTLSAPVNVKTTGQYFVGIMQKLPQMVR
-
Nucleotide Sequence: 996 bp     [Download]
>gi|560171871|ref|HG326223.1|:c4243843-4242848 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGAAAACTGCTTTTTCTACGCCGTTCGGTTCTCCCGAAGACGATTTGACCAACGCCGAGTTTGCCCGCC
TGTTGGGCAATACCGGCGTACAAGAATTCTATCGCGATATTAATCTGCAAGCCTTGCAGGACTCGCTGGA
CTGCAGCCTCGCCTTTCATGGCGTGGGAATTATTTTTTCCGACGGGCAAAACTCATTTTTAGTCCGCCCG
ACGCAGCACACCGGTTACTCGAACGCTTCGCAGGTTACCCACGTGGTCATCAGCAAAACGGTGGCTCATA
CCTCGCGCGTTGCCGCGACCAATACGCTGTCGGAAGCGTTGAGCAAACCCAGCGTCAGCAAAGAGCTGGC
CTCGGCCGCGCTGTCGTGTGGAACGCTGCTGGTATCGGTCTTTTTACTGGCGTCGGGCAGCGTCGCCGTG
CCATTTACCGGCGGTACCAGCTCAGCGGTGGCTTATCTGGGCTATGCCGGCATGGCCGCCAGCGCGTTGC
AGTGCGGTAATGGGCTGTACCGCGTCAACAAGCTTTATGACGGGAAAGGCGATGAATTGGCTCAGCTCGA
TTCAGAGCAGTGGTATATCGCCACCAGTACCGTGCTCGATGTGATCTCGCTGGCCAGCGCCGGGGCTGCC
CTGAAGGAAGCGACGATGACCTATCGTGCCATGCGCCGCATTTCGGCGCGCAAGGCGACGGAGTGGCTGA
AAAGCATGCCCCGCAGCGAAAGGAAGCGACTGACCGAAAACATCATTCGGGCGGAAAATCCGGGAATTTC
CAACAACGTTTTGAAAGAGATGGTGAAGAACGGCCTGTACCCGAAACGCTACCCGACGGAAGCGATCCAA
AACGGGCTGCGCCAGCAATTGCACTCGGCGCTCAATAACGCGTTGACGTTTGTCGGCAGCGGCATCAGCG
GCACCCTGTCGGCGCCGGTGAATGTGAAAACCACCGGGCAGTATTTTGTGGGCATTATGCAGAAATTGCC
GCAGATGGTGAGGTAA