SecReT6
Effector Protein ID: 560176449
-
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_4628
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]4979889..4980716 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSMDB11_4628 (Ssp5)
DescriptionSMA4628 (Ssp5)
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam RNAse_A_bac [PF18431], Evalue: 5.1e-27, Aligned region: 161..273
Protein Sequence: 275 a.a.     [Download]
>gi|560176449|ref|CDG15188.1| hypothetical protein [Serratia marcescens subsp. marcescens Db11]
MANEDELRIALSPVQLAAVLSDESVTEGETLSNRLLGGLGLAGGVVELMGAGVLCYAPDPTFITKVGCVV
VGTHSLDSIKAASNQMITGHPTTTDTYQSAVLLAQTLGADRETAYNVGLTVDIAVPFVFAGAVGAARVAS
VRMGRVKLVEHESVSGKYPGGHTLARHINIAPEALITRLARRPKLIAASTFRSVKEAEKYVSITVKANRA
DIVNWMKYASPGSRLSVYHNFKESVGYGVLRGSTDVYQCHRVGVVIEFTRYNGKPYFILSAFPAR
-
Nucleotide Sequence: 828 bp     [Download]
>gi|560171871|ref|HG326223.1|:4979889-4980716 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGGCGAATGAAGATGAGTTGCGCATTGCCCTGTCGCCGGTGCAGCTTGCGGCGGTGCTGTCTGATGAAA
GCGTCACTGAAGGTGAAACGCTCAGTAACCGTCTGCTTGGCGGTTTGGGGCTTGCCGGTGGTGTCGTTGA
GCTGATGGGGGCGGGGGTGTTGTGCTATGCGCCGGATCCGACGTTTATCACCAAAGTTGGGTGTGTAGTG
GTGGGAACGCATAGCCTGGACAGCATCAAAGCCGCTTCCAATCAGATGATTACTGGGCATCCAACAACTA
CCGATACTTATCAGTCTGCCGTTTTATTGGCGCAAACATTGGGTGCCGATCGGGAAACGGCCTATAACGT
TGGTTTAACGGTCGATATTGCCGTGCCTTTTGTCTTTGCCGGAGCGGTTGGCGCTGCCAGAGTCGCATCC
GTGCGTATGGGGCGGGTTAAGCTGGTTGAGCATGAGTCCGTTAGCGGTAAATATCCGGGCGGGCACACAT
TGGCTCGGCATATAAACATAGCTCCGGAAGCGCTTATTACCAGGCTAGCCAGGCGCCCGAAACTGATCGC
AGCAAGCACCTTCAGATCGGTAAAGGAGGCCGAAAAGTATGTTTCTATCACGGTAAAGGCGAACCGCGCA
GATATTGTGAATTGGATGAAGTACGCGTCTCCCGGCAGCCGTTTGAGCGTGTATCATAATTTCAAAGAAT
CAGTGGGTTATGGGGTATTGCGCGGCAGTACTGACGTCTATCAATGTCACCGGGTTGGCGTTGTGATTGA
ATTTACCCGCTATAATGGCAAACCTTACTTTATCCTTAGCGCTTTCCCTGCGAGATAA