SecReT6
Effector Protein ID: 560176492
-
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_4673
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]5022150..5022797 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorSMDB11_4673 (Ssp6)
DescriptionSMA4673 (Ssp6)
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 215 a.a.     [Download]
>gi|560176492|ref|CDG15231.1| hypothetical protein [Serratia marcescens subsp. marcescens Db11]
MAKGAKEIAQEMANAVNSKSNFFGGFIEGAISFPVDIGYLAYDFINTDNRSINRYDTERMLRLIKAGLAN
QHSLTKIVKLVVDEYLKKVDVDKVKRWVEKGSGKIAGRFVSNQVLMVNLGAVLSERVVIRLATGYALTSL
LTLGAMNSRAIHTSRQLRQRNPEIYDNLRRAGNLDLLYFLVEPKTKPFEQAIEIWRKNRGEFDRITELFF
EKVSK
-
Nucleotide Sequence: 648 bp     [Download]
>gi|560171871|ref|HG326223.1|:c5022797-5022150 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGGCAAAAGGTGCGAAGGAAATCGCCCAAGAGATGGCGAACGCTGTAAATTCAAAAAGTAATTTCTTTG
GCGGTTTTATCGAAGGGGCTATCTCCTTTCCCGTCGATATAGGATACCTGGCATATGATTTTATCAATAC
AGATAACCGCTCTATAAATCGATATGACACAGAAAGAATGCTTCGCCTCATTAAAGCTGGACTTGCTAAC
CAACACTCACTGACCAAAATCGTTAAACTTGTCGTTGACGAATATCTGAAAAAAGTCGATGTAGATAAAG
TCAAAAGATGGGTTGAAAAAGGATCCGGGAAAATTGCAGGTAGGTTTGTGAGCAATCAGGTTCTGATGGT
TAACTTAGGGGCGGTGCTTTCCGAACGGGTGGTTATTCGCCTCGCAACAGGTTATGCCCTAACGTCACTG
CTGACCCTCGGAGCTATGAACTCAAGAGCAATCCATACCTCACGCCAGTTACGACAGCGAAACCCTGAAA
TTTACGATAACTTAAGGCGTGCGGGAAATTTGGATCTCTTATATTTTCTGGTAGAACCCAAAACAAAGCC
ATTTGAACAAGCGATAGAGATTTGGCGAAAAAACAGAGGCGAGTTTGACCGCATTACCGAGCTATTTTTT
GAAAAGGTGTCGAAATGA

Reference
(1) Giuseppina Mariano, Katharina Trunk, David J Williams, Laura Monlezun, Henrik Strahl, Samantha J Pitt, Sarah J Coulthurst (2019). A Family of Type VI Secretion System Effector Proteins That Form Ion-Selective Pores. Nat Commun. 10(1):5484. [PudMed:31792213] experimental
 
experimental experimental literature