SecReT6
Effector Protein ID: 563652588
-
SecReT6 ID876
T6SS typeA1
Gene symbol-
Locus tagQ786_05190
StrainSalmonella enterica subsp. enterica serovar Agona str. 24249
Repliconchromosome [GenBank: NC_022991] [Browse all T6SS(s) in this replicon]
Location [Strand]1112285..1112803 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectoridrA
DescriptionHcp protein
UniProt IDV5S1N3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.90E-35, Aligned region: 6..155
DCAF15_WD40 [PF14939], Evalue: 0.004, Aligned region: 93..136
Protein Sequence: 172 a.a.     [Download]
>gi|563652588|ref|YP_008860649.1| hypothetical protein Q786_05190 [Salmonella enterica subsp. enterica serovar Agona str. 24249]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPSGQRSHKPFIF
TVALNKAVPLLYNALASGEMLPKTELHWWRTSVEGKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQ
LLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|563651606|ref|NC_022991.1|:1112285-1112803 Salmonella enterica subsp. enterica serovar Agona str. 24249, complete genome
ATGCCAACACCGTGTTACATCTCAATTACGGGGCAAACCCAGGGCAATATCACCGCTGGTGCATTCACCG
CAGATTCTGTCGGCAATATCTACGTGCAGGGTCACGAGGATGAAATGCTGGTACAGGAATTCCTGCATAA
CGTGACCGTACCCACCGATCCACAGTCCGGGCAGCCGAGCGGCCAGCGTTCGCACAAGCCGTTCATTTTT
ACCGTGGCGCTGAACAAAGCCGTACCGCTGCTGTACAACGCGCTGGCGTCCGGTGAAATGCTGCCGAAAA
CCGAACTGCACTGGTGGCGTACTTCCGTTGAAGGCAAGCAGGAGCATTACTTCACCACCCGCCTGACGGA
CTCAACGATTGTGGATATGAAACTGCATATGCCGCACTGTCAGGACCCGGCAAAGCGCGAATTCACGCAG
TTGCTCGAAGTCTCGCTGGCCTACCGCAAAATCGAGTGGGAACACGTCAAATCCGGCACCTCTGGCGCGG
ATGACTGGCGCGCGCCGCTGGAAGCGTAA