SecReT6
Effector Protein ID: 563654485
SecReT6 ID876
T6SS typeA1
Gene symbol-
Locus tagQ786_15205
StrainSalmonella enterica subsp. enterica serovar Agona str. 24249
Repliconchromosome [GenBank: NC_022991] [Browse all T6SS(s) in this replicon]
Location [Strand]3172877..3173362 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorROD_34191
DescriptionHcp protein
UniProt IDV5S4L2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.20E-38, Aligned region: 5..135
Protein Sequence: 161 a.a.     [Download]
>gi|563654485|ref|YP_008862569.1| hypothetical protein Q786_15205 [Salmonella enterica subsp. enterica serovar Agona str. 24249]
MDAIFLKLDNIKGESQVGGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTKFVDLATPVLN
EYCCSGRLIRTAVLTLCRNDDGKMRSLIVYTLTNVLISQLSVSGGAGGKPVETMSLNFTKIEWQITAEKP
DGAQQESRTSVWDLAMDQIGK
-
Nucleotide Sequence: 486 bp     [Download]
>gi|563651606|ref|NC_022991.1|:c3173362-3172877 Salmonella enterica subsp. enterica serovar Agona str. 24249, complete genome
ATGGATGCGATTTTTTTAAAGCTCGACAATATCAAAGGCGAAAGCCAGGTTGGAGGCTTTGAAGATCAGA
TAGAGATCATGTCTTATAGCCACAATGTGGCAATGCAGGTAAATAACGATGTTAGCCTCACTGAGCGGAC
TTCCGGGCGCGCGCATGTTGGTGAAATGTCGCTCACCAAATTTGTCGACCTCGCCACGCCTGTGCTCAAT
GAGTACTGCTGTAGCGGGAGGCTAATTAGAACCGCGGTGCTGACGTTGTGCCGCAATGACGACGGCAAAA
TGCGGTCGCTTATCGTTTATACCCTGACAAACGTGCTGATATCACAACTCAGTGTTAGCGGCGGCGCCGG
CGGTAAGCCGGTGGAAACGATGTCGCTGAACTTCACGAAAATCGAATGGCAAATCACTGCCGAGAAACCA
GACGGCGCTCAACAGGAGTCCAGAACGTCAGTATGGGATCTGGCGATGGACCAGATAGGGAAATGA