SecReT6
Effector Protein ID: 56414600
-
SecReT6 ID79
T6SS typeA3
Gene symbol-
Locus tagSPA2487
StrainSalmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150
Repliconchromosome [GenBank: NC_006511] [Browse all T6SS(s) in this replicon]
Location [Strand]2590242..2590727 [-]
Productcytoplasmic protein
Effector typeProtein
Homologous effectorSTM0277
DescriptionTae4_TM
UniProt IDQ5PFC2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF4285 [PF14113], Evalue: 2.10E-26, Aligned region: 40..141
Protein Sequence: 161 a.a.     [Download]
>gi|56414600|ref|YP_151675.1| cytoplasmic protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150]
MNRPSFNAAWLAFRKVNHSVADVGSIIGGNVGKNITGGYFQNACPIRMGYVLNATGFPIARNSPYAKVSG
ADNKFYIYRVNDMIDHLTHTMGKPDLIVNNPKQSDFIGKKGIIVVKGHGWSNARGHVTLWNGSICSDQCH
LLNDPDNGPFVPEVGTLWILP
-
Nucleotide Sequence: 486 bp     [Download]
>gi|56412276|ref|NC_006511.1|:c2590727-2590242 Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 chromosome, complete genome
ATGAACAGACCTTCATTCAATGCAGCGTGGCTAGCTTTTAGGAAGGTGAATCATTCCGTCGCTGATGTGG
GTAGCATTATTGGTGGAAACGTTGGGAAAAATATAACTGGTGGTTATTTTCAAAATGCCTGCCCTATTCG
AATGGGCTATGTTTTGAATGCGACAGGATTCCCAATAGCCCGTAACTCTCCGTATGCAAAGGTTAGTGGT
GCCGATAATAAATTCTATATTTATCGAGTGAATGATATGATTGATCATCTTACTCATACTATGGGCAAGC
CCGATCTTATTGTTAATAATCCGAAACAGAGTGACTTTATAGGGAAGAAAGGAATTATCGTAGTAAAAGG
GCATGGCTGGAGCAATGCCAGAGGACACGTTACATTATGGAATGGCAGTATCTGTTCAGATCAGTGCCAC
TTATTAAATGACCCAGATAATGGACCATTTGTTCCTGAAGTTGGGACTCTGTGGATACTGCCGTGA