SecReT6
Effector Protein ID: 56414602
-
SecReT6 ID79
T6SS typeA3
Gene symbol-
Locus tagSPA2489
StrainSalmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150
Repliconchromosome [GenBank: NC_006511] [Browse all T6SS(s) in this replicon]
Location [Strand]2591021..2591506 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorSciK
DescriptionHcp protein
UniProt IDQ5PFC0
KEGG IDspt:SPA2489
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-40, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|56414602|ref|YP_151677.1| hypothetical protein SPA2489 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150]
MAYDIFLKIDGIDGESMDDKHKNEIEVLGWRWNIHQESTMHAGSGLGSGKVSVTNLEFEHYIDRASPNLF
KYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGNREGEIASRERIELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
-
Nucleotide Sequence: 486 bp     [Download]
>gi|56412276|ref|NC_006511.1|:c2591506-2591021 Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 chromosome, complete genome
ATGGCTTATGACATTTTTTTGAAAATTGACGGCATTGACGGCGAGTCAATGGATGACAAACACAAAAATG
AAATTGAAGTACTGGGCTGGCGCTGGAATATTCATCAGGAATCCACCATGCACGCCGGTAGTGGCCTCGG
CTCCGGTAAGGTCTCTGTCACTAATCTGGAATTCGAGCATTATATCGATCGCGCCAGCCCGAATCTGTTC
AAATACTGTGCCTCCGGTAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAACCCGT
TGGAGTACCTCAAGTACACCTTTACCGATCTGATCGTTGCGGTCGTTTCACCTAGCGGTAACAGAGAAGG
CGAAATCGCGTCTCGCGAGCGGATTGAGCTCTCCTTCAGCACCGTGAAGCAGGAATACGTGGTGCAGAAC
CAGCAGGGTGGCAGCGGCGGCACCATCACCGCAGGCTACGACTTCAAGGCCAACAAAGAAATTTAA