SecReT6
Effector Protein ID: 56415073
-
SecReT6 ID79
T6SS typeA3
Gene symbol-
Locus tagSPA2999
StrainSalmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150
Repliconchromosome [GenBank: NC_006511] [Browse all T6SS(s) in this replicon]
Location [Strand]3099798..3100283 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorHcp
DescriptionHcp protein
UniProt IDQ5PMN5
KEGG IDspt:SPA2999
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.90E-38, Aligned region: 5..135
Protein Sequence: 161 a.a.     [Download]
>gi|56415073|ref|YP_152148.1| hypothetical protein SPA2999 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150]
MDAIFLKLDNIKGESQVEGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTKFVDLATPVLN
EYCCSGRLIRTAVLTLCRNDGGKMRSLIVYTLTNVLISQLSVSGGAGGKPVETMSLNFTKIEWQITAEKS
DGAQQESRTSVWDLAMDQIGK
-
Nucleotide Sequence: 486 bp     [Download]
>gi|56412276|ref|NC_006511.1|:c3100283-3099798 Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 chromosome, complete genome
ATGGATGCGATTTTTTTAAAGCTCGACAATATCAAAGGCGAAAGCCAGGTTGAAGGCTTTGAAGATCAGA
TAGAGATCATGTCTTATAGCCACAATGTGGCAATGCAGGTAAATAACGATGTTAGCCTCACCGAGCGGAC
TTCCGGGCGTGCGCATGTTGGTGAAATGTCGCTCACCAAATTTGTCGACCTCGCCACGCCTGTGCTCAAT
GAGTACTGCTGTAGCGGGAGGCTAATTAGAACCGCGGTGCTGACGTTGTGCCGCAATGACGGCGGCAAAA
TGCGGTCGCTTATCGTTTATACCCTGACAAACGTGCTGATATCACAACTCAGTGTTAGCGGCGGCGCCGG
CGGTAAGCCGGTGGAAACGATGTCGCTGAACTTCACGAAAATCGAATGGCAAATCACTGCCGAGAAATCA
GACGGCGCTCAACAGGAGTCCAGAACGTCAGTATGGGATCTGGCGATGGACCAGATAGGGAAATGA