SecReT6
Effector Protein ID: 564949985
-
SecReT6 ID877
T6SS typeA3
Gene symbol-
Locus tagU769_00480
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]116895..118835 [+]
Producttype VI secretion protein ImpA
Effector typeProtein
Homologous effectorPA0091
Descriptiontype VI secretion system Vgr family protein
UniProt IDV5SQY5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.90E-88, Aligned region: 29..329
Phage_base_V [PF04717], Evalue: 2.00E-26, Aligned region: 369..462
Protein Sequence: 646 a.a.     [Download]
>gi|564949985|ref|YP_008882555.1| type VI secretion protein ImpA [Pseudomonas aeruginosa MTB-1]
MGLMQLTRLVQVDCPLGPDVLLLQRMEGREELGRLFAYELHLVSENPNLPLEQLLGKPMSLSLELPGGSR
RFFHGIVARCSQVAGHGQFAGYQATLRPWPWLLTRTSDCRIFQNQSVPEIIKQVFRDLGFSDFEDALTRP
YREWEYCVQYRETSFDFISRLMEQEGIYYWFRHEQKRHILVLSDAYGAHRSPGGYASVPYYPPTLGHRER
DHFFDWQMAREVQPGSLTLNDYDFQRPGARLEVRSNIARPHAAADYPLYDYPGEYVQSQDGEQYARNRIE
AIQAQHERVRLRGVVRGIGAGHLFRLSGYPRDDQNREYLVVGAEYRVVQELYETGSGGAGSQFESELDCI
DASQSFRLLPQTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGMKSRSSKGGTPANFNEIRM
EDKKGAEQLYIHAERNQDNLVENDASLSVGHDRNKSIGHDELARIGNNRTRAVKLNDTLLVGGAKSDSVT
GTYLIEAGAQIRLVCGKSVVEFNADGTINISGSAFNLYASGNGNIDTGGRLDLNSGGASEVDAKGKGVQG
TIDGQVQAMFPPPAKG
-
Nucleotide Sequence: 1941 bp     [Download]
>gi|564949884|ref|NC_023019.1|:116895-118835 Pseudomonas aeruginosa MTB-1, complete genome
ATGGGATTGATGCAACTGACCCGCCTGGTCCAGGTGGATTGCCCGCTGGGGCCGGACGTGCTGCTGTTGC
AGCGCATGGAGGGACGCGAGGAACTGGGACGGTTGTTCGCCTACGAGCTGCACCTGGTCTCGGAAAACCC
CAACCTGCCGCTGGAACAGCTGCTCGGCAAGCCGATGAGCCTGTCCCTGGAGCTGCCCGGCGGCAGCCGG
CGCTTCTTCCACGGCATCGTCGCGCGTTGCAGCCAGGTGGCCGGGCACGGCCAGTTCGCCGGCTACCAGG
CCACCCTGCGGCCCTGGCCGTGGCTGCTGACGCGTACCTCGGACTGCCGCATCTTCCAGAACCAGAGCGT
GCCGGAGATCATCAAGCAGGTGTTCCGCGACCTCGGCTTTTCCGATTTCGAGGATGCCCTCACGCGCCCC
TACCGCGAGTGGGAATACTGCGTGCAGTACCGCGAGACCAGCTTCGACTTCATCAGCCGGCTGATGGAAC
AGGAAGGCATCTACTACTGGTTCCGCCATGAGCAGAAGCGCCACATCCTGGTGCTCTCCGACGCCTACGG
CGCGCATCGCAGCCCGGGTGGCTACGCCAGCGTGCCGTACTACCCGCCGACCCTCGGCCATCGCGAGCGC
GACCACTTCTTCGACTGGCAGATGGCACGCGAGGTCCAGCCCGGTTCGCTGACCCTCAACGACTACGACT
TCCAGCGCCCCGGCGCGCGCCTGGAGGTGCGTTCGAACATCGCCCGGCCGCACGCGGCGGCCGACTACCC
GCTGTACGACTATCCCGGCGAATACGTGCAGAGCCAGGACGGCGAGCAGTACGCGCGCAACCGCATCGAG
GCGATCCAGGCGCAGCACGAGCGCGTGCGCCTGCGCGGCGTGGTGCGCGGGATCGGCGCCGGGCACCTGT
TCCGCCTGAGCGGCTATCCGCGCGATGACCAGAACCGCGAGTACCTGGTGGTCGGCGCCGAATACCGGGT
GGTCCAGGAACTCTACGAAACCGGCAGCGGCGGCGCCGGCTCGCAGTTCGAGAGCGAGCTGGACTGCATC
GACGCCAGCCAGTCGTTCCGCCTCCTGCCGCAGACCCCGGTGCCGGTGGTGCGCGGTCCGCAGACCGCGG
TGGTGGTCGGTCCCAAGGGCGAGGAGATCTGGACCGACCAGTACGGCCGGGTCAAGGTGCATTTCCACTG
GGATCGCCACGACCAGTCGAACGAGAACAGCTCCTGCTGGATTCGCGTGTCCCAGGCCTGGGCCGGGAAG
AACTGGGGTTCGATGCAGATCCCGCGGATCGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCGG
ACCGGCCGATCATCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGC
CACCCAGAGCGGGATGAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATG
GAGGACAAGAAGGGCGCCGAGCAGTTATACATCCACGCCGAGCGCAACCAGGACAACCTGGTCGAGAACG
ATGCCTCGCTGTCGGTCGGCCACGACCGCAACAAGAGCATCGGCCACGACGAGCTGGCGCGCATCGGCAA
CAACCGCACCCGCGCGGTGAAGCTCAACGACACCCTGCTGGTGGGCGGGGCGAAGAGCGACAGCGTCACC
GGCACCTACCTGATCGAGGCCGGCGCGCAGATCCGCCTGGTCTGCGGCAAGAGCGTGGTGGAGTTCAACG
CCGACGGCACCATCAATATCTCCGGCAGCGCCTTCAACCTCTACGCCAGCGGCAACGGCAACATCGACAC
CGGCGGCCGCCTCGACCTCAATTCCGGCGGCGCCAGCGAGGTCGACGCCAAGGGCAAGGGCGTGCAGGGC
ACCATCGACGGCCAGGTACAGGCGATGTTTCCGCCGCCGGCGAAGGGCTGA