SecReT6
Effector Protein ID: 564949988
-
SecReT6 ID877
T6SS typeA3
Gene symbol-
Locus tagU769_00495
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]119470..120852 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA0093
DescriptionTse6
UniProt IDV5SPG9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 7.40E-15, Aligned region: 4..16
PAAR_motif [PF05488], Evalue: 7.40E-15, Aligned region: 78..153
PAAR_motif [PF05488], Evalue: 7.40E-15, Aligned region: 292..302
DUF4150 [PF13665], Evalue: 0.0065, Aligned region: 84..104
DUF4150 [PF13665], Evalue: 0.0065, Aligned region: 125..146
DUF4150 [PF13665], Evalue: 0.0065, Aligned region: 348..374
Protein Sequence: 460 a.a.     [Download]
>gi|564949988|ref|YP_008882558.1| hypothetical protein U769_00495 [Pseudomonas aeruginosa MTB-1]
MDAQAAARLGDEIAHGFGVAAMVAGAVAGALIGAAVVAATAATGGLAAVILAGSIAAGGLSMFQIVKGLT
TIFELPEPTTGVLIRGSFNVYVNSRNAMRAGDDVSATCSGLPLNHPLWPFPVLIAEGSATVYINGKPAAR
LQSKMVCGAHIKTGSQNTFIGGPTERVAFVLDLEEWLHTGLEALGLAALAGGLLLAAMAGVAALVGVVAI
GGLMMGGMALLGDLGDRLGPGYRDLFQGVAGMALLGFGPKMARLGNAPKGAPKTQVPKGFEKVYGKAPAA
KAEIDAVADGLAAKHGGRVAKAPIKSRERAMQKINNDYKGDPTKIKDLARNTIIVEGDKVNTVAAELANR
GAKVKVIDGNADPLGYSGVNSTMNTKAGIPGEIQVNSPEMIYAKESEDMARILLGNDTYDAVAAKAGVPG
GQGHKYYEDWRVLDPKSSEAQAIAEKSRAYYDAVRKGNGN
-
Nucleotide Sequence: 1383 bp     [Download]
>gi|564949884|ref|NC_023019.1|:c120852-119470 Pseudomonas aeruginosa MTB-1, complete genome
ATGGATGCGCAAGCCGCCGCCCGACTGGGCGATGAGATAGCCCACGGTTTCGGTGTCGCCGCGATGGTCG
CCGGAGCCGTGGCCGGAGCCCTGATCGGCGCCGCCGTGGTCGCCGCCACCGCCGCCACCGGCGGCCTGGC
CGCGGTGATCCTGGCCGGTTCGATCGCCGCCGGCGGGCTGTCGATGTTCCAGATCGTCAAGGGCCTGACC
ACCATCTTCGAGCTACCCGAGCCGACCACCGGGGTGCTCATACGCGGCAGCTTCAACGTCTACGTGAACA
GTCGCAACGCGATGCGCGCCGGCGACGACGTCTCCGCCACCTGCAGCGGCCTGCCGCTGAACCATCCGCT
GTGGCCGTTCCCGGTGCTGATCGCCGAAGGCAGCGCCACCGTGTACATCAACGGCAAGCCGGCGGCGCGC
CTGCAGAGCAAGATGGTCTGCGGCGCGCACATCAAGACCGGCAGCCAGAACACCTTCATCGGCGGCCCCA
CCGAGCGGGTGGCCTTCGTCCTCGATCTGGAGGAATGGCTGCACACCGGCCTCGAGGCGCTGGGCCTGGC
GGCCCTTGCCGGCGGCCTGCTGCTGGCGGCGATGGCCGGGGTCGCGGCGCTGGTTGGAGTGGTCGCCATC
GGCGGCCTGATGATGGGCGGCATGGCCCTGCTCGGCGACCTCGGCGACCGCCTCGGTCCCGGCTACCGCG
ACCTGTTCCAGGGCGTGGCCGGCATGGCGCTGCTGGGCTTCGGACCGAAGATGGCACGGCTCGGCAACGC
ACCCAAGGGCGCGCCGAAGACCCAGGTGCCGAAAGGCTTCGAGAAGGTCTATGGCAAGGCGCCGGCAGCC
AAGGCCGAGATCGACGCGGTGGCCGACGGACTGGCGGCGAAGCACGGCGGCAGGGTCGCCAAGGCACCGA
TCAAGTCGCGCGAACGCGCCATGCAGAAGATCAACAACGACTACAAGGGCGATCCGACCAAGATCAAGGA
TCTGGCCCGCAACACCATCATCGTCGAAGGCGACAAGGTGAACACCGTTGCCGCCGAGCTGGCCAACCGC
GGCGCCAAGGTCAAGGTGATCGACGGCAACGCCGACCCGCTCGGCTACAGCGGGGTGAACTCGACGATGA
ACACCAAGGCCGGGATACCCGGCGAGATCCAGGTCAACTCGCCGGAGATGATCTACGCCAAGGAGTCGGA
GGACATGGCTCGCATCCTCCTCGGCAACGACACCTACGACGCGGTGGCGGCCAAGGCCGGCGTACCCGGA
GGGCAGGGCCACAAGTACTATGAGGACTGGCGGGTACTGGATCCGAAGTCCTCGGAGGCCCAGGCCATCG
CCGAGAAGAGCCGGGCGTACTACGACGCAGTGAGGAAAGGCAATGGCAATTGA