SecReT6
Effector Protein ID: 564951360
-
SecReT6 ID877
T6SS typeA3
Gene symbol-
Locus tagU769_07370
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]1587226..1588452 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA3484
DescriptionTse3
UniProt IDV5SUT5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 408 a.a.     [Download]
>gi|564951360|ref|YP_008883930.1| hypothetical protein U769_07370 [Pseudomonas aeruginosa MTB-1]
MTATSDLIESLISYSWDDWQVTRQEARRVIAAIRNDNVPDATIAALDKSGSLIKLFQRVGPPELARSLIA
SIAGRTTMQRYQARNALIRSLINNPLGTQTDNWIYFPTITFFDICADLADAAGRLGFAAAGATGVASQAI
QGPFSGVGATGVNPTDLPSIAFGDQLKLLNKDPATVTKYSNPLGDLGAYLSQLSPQDKLNQAQTLVGQPI
STLFPDAYPGNPPSRAKVMSAAARKYDLTPQLIGAIILAEQRDQTRDEDAKDYQAAVSIKSANTSIGLGQ
VVVSTAIKYELFTDLLGQPVRRGLSRKAVATLLASDEFNIFATARYIRYVANLASQQDLRKLPKTRGAFP
SIDLRAYAGNPRNWPRDNVRALASEYTSRPWDDNLSPGWPMFVDDAYATFLDPGMRFP
-
Nucleotide Sequence: 1227 bp     [Download]
>gi|564949884|ref|NC_023019.1|:c1588452-1587226 Pseudomonas aeruginosa MTB-1, complete genome
ATGACCGCCACCAGCGACCTGATCGAGTCACTGATTTCCTATAGCTGGGACGACTGGCAGGTGACCCGCC
AGGAAGCCCGCCGGGTGATCGCCGCGATCCGCAACGACAACGTGCCCGATGCGACCATCGCCGCACTCGA
CAAGAGCGGCTCGCTGATCAAGCTGTTCCAGCGGGTGGGCCCGCCGGAACTGGCGCGCTCGCTGATCGCC
AGCATCGCCGGGCGCACCACCATGCAGCGCTACCAGGCACGCAATGCCTTGATCCGCAGCCTGATCAACA
ATCCCCTGGGCACCCAGACCGACAACTGGATCTACTTCCCCACCATCACTTTCTTCGACATCTGCGCCGA
CCTCGCCGACGCCGCCGGTCGCCTGGGCTTCGCCGCGGCCGGCGCCACCGGGGTGGCCAGCCAGGCGATC
CAGGGTCCGTTCAGCGGGGTCGGCGCCACCGGCGTCAATCCGACCGACCTGCCGTCCATTGCCTTCGGCG
ACCAGCTCAAGCTGCTCAACAAGGACCCGGCGACCGTCACCAAGTACAGCAACCCGCTCGGCGACCTGGG
CGCCTACCTGAGCCAACTGTCGCCGCAAGACAAGCTGAACCAGGCACAGACGCTGGTCGGCCAGCCGATC
AGCACGCTGTTCCCCGACGCCTATCCGGGCAACCCGCCGTCGCGGGCCAAGGTCATGTCCGCGGCTGCGC
GCAAGTACGACCTGACGCCGCAACTGATCGGCGCGATCATCCTCGCCGAGCAGCGTGACCAGACCCGCGA
CGAAGACGCCAAGGACTATCAGGCGGCAGTCAGCATCAAGAGCGCCAACACCTCCATCGGCCTCGGCCAG
GTGGTGGTCTCCACCGCGATCAAGTACGAGCTGTTCACCGACCTGCTCGGCCAGCCGGTGCGCCGCGGCC
TGTCGCGCAAGGCGGTCGCCACCCTGCTGGCTTCCGACGAATTCAACATCTTCGCCACCGCCCGTTACAT
CCGCTACGTCGCCAACCTGGCGTCGCAACAGGACCTGCGCAAGCTGCCGAAGACCCGCGGCGCATTTCCC
TCCATCGATCTCCGCGCCTACGCCGGCAATCCGCGCAACTGGCCGCGGGACAATGTCCGCGCGCTGGCCT
CGGAATACACCTCGCGGCCCTGGGACGACAACCTGTCGCCGGGCTGGCCGATGTTCGTCGACGATGCCTA
CGCCACCTTCCTCGACCCTGGAATGAGGTTCCCATGA