SecReT6
Effector Protein ID: 564952202
-
SecReT6 ID877
T6SS typeA3
Gene symbol-
Locus tagU769_11645
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]2466532..2467008 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2702
DescriptionTse2
UniProt IDV5SUW2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 158 a.a.     [Download]
>gi|564952202|ref|YP_008884772.1| hypothetical protein U769_11645 [Pseudomonas aeruginosa MTB-1]
MSYDYEKTSLTLYRAVFKANYDGDVGRYLRPDKELAEAAEVAPLLHPTFDSPNTPGVPARAPDIVAGRDG
LYAPDTGGTSVFDRAGVLRRADGDFVIPDGTDIPPDLKVKQDSYNKRLQATHYTIMPAKPMYREVLMGQL
DNFVRNAIRRQWEKARGL
-
Nucleotide Sequence: 477 bp     [Download]
>gi|564949884|ref|NC_023019.1|:c2467008-2466532 Pseudomonas aeruginosa MTB-1, complete genome
ATGTCCTACGACTACGAGAAAACCAGCCTCACCCTCTACCGGGCGGTATTCAAGGCCAACTACGACGGCG
ACGTCGGTCGCTACCTGCGTCCCGACAAGGAACTCGCCGAGGCTGCGGAAGTCGCCCCGCTGCTGCATCC
GACCTTCGACAGCCCCAACACCCCTGGCGTCCCCGCCCGCGCGCCAGACATCGTCGCCGGCCGCGACGGC
CTCTACGCCCCGGACACCGGCGGCACCTCGGTGTTCGACCGCGCCGGCGTGCTGCGCCGCGCCGACGGCG
ACTTCGTGATACCCGACGGCACCGACATCCCGCCGGACCTTAAGGTGAAACAGGACAGCTACAACAAGCG
CCTGCAAGCCACCCACTACACCATCATGCCGGCCAAGCCGATGTACCGGGAGGTCCTCATGGGCCAACTG
GACAACTTCGTGCGCAACGCCATCCGCCGCCAATGGGAAAAAGCCCGCGGGCTCTAG