SecReT6
Effector Protein ID: 564955425
-
SecReT6 ID878
T6SS typeA4a
Gene symbol-
Locus tagU769_27805
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]5992350..5994587 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA5089
DescriptionPldB
UniProt IDV5T6J6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam PLDc_2 [PF13091], Evalue: 8.20E-07, Aligned region: 56..117
PLDc_2 [PF13091], Evalue: 8.20E-07, Aligned region: 281..332
PLDc_2 [PF13091], Evalue: 8.20E-07, Aligned region: 433..466
PLDc_2 [PF13091], Evalue: 8.20E-07, Aligned region: 633..688
PLDc [PF00614], Evalue: 1.20E-06, Aligned region: 303..329
PLDc [PF00614], Evalue: 1.20E-06, Aligned region: 640..661
Protein Sequence: 745 a.a.     [Download]
>gi|564955425|ref|YP_008887995.1| hypothetical protein U769_27805 [Pseudomonas aeruginosa MTB-1]
MSDLYKPQTLKLYAQQAGSVRLTLDWFANKAFYPPRAGVHIKPLINGQAAFDAVHAAMEAARHSIDIITW
GFDPAMRFKRPDGPRIGELLQTKGREGVQARVLVWSNQLARLKENTIPGAGVGGSGGTWAGSGVASGSAV
DNEVLRLEQRRQHNLNLIARQQEALERSERLHREGRLPSFDPRGAAHARARIAELEAENAEIQRTLDSSE
AQGYGGKRGSGGTRQDPWGQIFTRDWFKAVRGGGLQNVEFRTRDFEQTARPVMNGEQVRLVNGRLQSLIH
LLRADGIDDLGIGQLLVLTQFASHHQKMVLVDYGSPQAIGFVMGHNMHRNYWDTSAHLFDDRAAGRDPGF
GPWQDISMQVQGPVLADLSRNFSEAWDLETPWYKRWFSTPSLTAERDALPLPKIATPASNSVAQICRTQP
QDGERSILEHYLKALGNATDYVYMENQYFRYAGFAERLRKTAQVRKARGVPGDLYLFVVTNTPDSSDASK
TTYDMMKGLGQEQLMPQVQRDLAHDLREKREQLKQVRENLHPDPYVRRGQENNIERLERKIEALEEKGVT
PEVEQRLGDLGAQEIPGLAKNTGEDDKPYQLAEVPGLKVVVATLATSDPAPGSPPLARLSAEAEAALGAP
PLKARYKHIYVHSKLLLVDDLYTLLSSANINVRSMHGDSELGIAQPNPDLARAMREELWELHAQKVAATT
EKNFKLWNQKMDANWRQQRKDEPLVANLLRFWDVVTPYSPGLTVD
-
Nucleotide Sequence: 2238 bp     [Download]
>gi|564949884|ref|NC_023019.1|:c5994587-5992350 Pseudomonas aeruginosa MTB-1, complete genome
ATGAGCGACCTGTACAAACCGCAGACCCTCAAGCTGTACGCGCAACAGGCCGGCAGCGTCCGGCTGACCC
TCGACTGGTTCGCCAACAAGGCTTTCTACCCGCCGCGCGCGGGTGTGCACATCAAGCCGCTGATCAATGG
CCAGGCGGCCTTCGACGCGGTGCATGCGGCGATGGAAGCGGCCCGGCACAGCATCGACATCATCACCTGG
GGCTTCGACCCGGCCATGCGTTTCAAACGCCCCGACGGACCGCGAATCGGCGAATTGCTGCAGACGAAGG
GCCGCGAAGGGGTACAGGCGCGGGTGCTGGTCTGGAGCAACCAGCTCGCCAGGCTCAAGGAAAACACCAT
CCCCGGGGCCGGCGTCGGCGGTTCCGGCGGCACCTGGGCGGGCTCGGGCGTCGCCAGCGGCAGCGCAGTG
GACAACGAGGTGCTGCGGCTGGAGCAGCGGCGCCAGCATAACCTCAACCTCATCGCGCGGCAGCAGGAAG
CCCTGGAACGCTCGGAACGGCTGCACCGCGAAGGCAGGCTGCCGAGCTTCGACCCGCGGGGCGCCGCCCA
CGCGCGGGCGCGCATCGCCGAGCTGGAGGCGGAGAACGCCGAGATCCAGCGCACTCTCGACAGCAGCGAG
GCCCAGGGCTACGGCGGCAAGCGCGGTTCCGGCGGCACCCGCCAGGATCCCTGGGGGCAGATATTCACCC
GCGACTGGTTCAAGGCGGTACGCGGCGGTGGGTTGCAGAACGTCGAGTTCCGTACCCGCGACTTCGAGCA
GACGGCCAGGCCGGTGATGAACGGCGAGCAAGTGCGCCTCGTCAATGGGCGACTGCAAAGCCTGATCCAC
CTGCTGCGCGCCGATGGCATCGACGACCTGGGCATCGGCCAGTTGCTGGTACTCACCCAGTTCGCCAGCC
ATCACCAGAAGATGGTCCTGGTCGACTATGGCAGCCCGCAGGCCATCGGCTTCGTCATGGGTCACAACAT
GCACCGCAACTACTGGGACACCAGCGCCCACCTGTTCGACGACCGCGCCGCCGGTCGCGATCCCGGGTTC
GGGCCCTGGCAGGATATCTCCATGCAAGTCCAGGGACCGGTGCTGGCCGACCTCAGCCGCAACTTCAGCG
AGGCCTGGGACCTCGAGACGCCGTGGTACAAGCGCTGGTTCTCGACGCCATCGCTGACCGCCGAGCGCGA
CGCCTTGCCGCTGCCGAAGATCGCCACGCCCGCCAGCAACAGCGTCGCGCAGATTTGCCGGACCCAGCCA
CAGGACGGCGAGCGCTCGATCCTGGAGCACTATCTCAAGGCCCTGGGCAATGCCACCGACTACGTCTACA
TGGAAAACCAGTACTTCCGTTATGCCGGCTTCGCCGAGCGCCTGCGGAAGACTGCGCAGGTGCGCAAGGC
CCGGGGCGTGCCCGGCGACCTGTACCTGTTCGTCGTGACCAACACCCCCGACTCCAGCGACGCCTCGAAG
ACCACCTACGACATGATGAAAGGCCTGGGCCAGGAGCAACTGATGCCGCAGGTACAGCGCGACCTGGCGC
ATGACTTGCGGGAAAAGCGGGAGCAGTTGAAGCAGGTCAGGGAAAACCTACATCCCGATCCCTATGTCCG
GCGCGGCCAGGAAAACAACATCGAACGGCTGGAGCGCAAGATCGAAGCGCTCGAAGAGAAAGGCGTGACG
CCGGAAGTCGAGCAACGCCTCGGCGATCTCGGCGCGCAGGAGATTCCCGGACTGGCGAAGAACACCGGCG
AGGACGACAAGCCCTATCAACTCGCCGAAGTACCCGGCCTCAAGGTGGTCGTCGCCACCCTGGCCACCAG
CGACCCCGCCCCCGGCAGCCCGCCGCTAGCGCGCCTGTCCGCCGAAGCCGAGGCCGCCCTCGGGGCACCG
CCGCTGAAGGCGCGCTACAAGCACATCTACGTGCACTCCAAGCTGCTGCTGGTGGATGACCTCTATACCC
TGCTCAGCTCGGCCAATATCAATGTCCGCAGCATGCATGGCGACAGCGAGTTGGGGATTGCCCAGCCCAA
TCCGGATTTGGCGAGGGCGATGCGGGAGGAGTTGTGGGAGCTACATGCCCAGAAAGTGGCTGCGACAACC
GAAAAAAACTTCAAACTCTGGAATCAGAAAATGGATGCGAATTGGAGACAGCAACGTAAAGACGAGCCTT
TGGTAGCTAACTTGCTTCGCTTCTGGGATGTCGTGACACCTTATAGCCCCGGTCTCACGGTGGACTGA