SecReT6
Effector Protein ID: 565631949
-
SecReT6 ID883
T6SS typeA3
Gene symbol-
Locus tagP262_p1093
StrainCronobacter sakazakii CMCC 45402
Repliconchromosome [GenBank: NC_023024] [Browse all T6SS(s) in this replicon]
Location [Strand]76054..76620 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSMA3455
DescriptionHcp protein
UniProt IDV5U607
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.10E-35, Aligned region: 34..163
Candida_ALS [PF05792], Evalue: 0.0026, Aligned region: 130..152
Protein Sequence: 188 a.a.     [Download]
>gi|565631949|ref|YP_008888612.1| hypothetical protein P262_p1093 [Cronobacter sakazakii CMCC 45402]
MNKLTVKLNYLPAGFAYSHLLSDNTEYYMAIDMFLKVEGVTGESKDANHASWIDVLSFNWGAAQPGNMAV
GGGGGAGKVNFQDLAVQAIVDKGTPAILKFCASGKHVNKVELSVCKAGGQQVEYSKIVLEDVLVTRTEFT
GVGQTDTVLVNYYFQAAKVNFHYWEQSNQGTKGAETKAGWDIKQNKEL
-
Nucleotide Sequence: 567 bp     [Download]
>gi|565631883|ref|NC_023024.1|:76054-76620 Cronobacter sakazakii CMCC 45402 plasmid p1, complete sequence
TTGAATAAACTTACAGTGAAACTGAATTATTTGCCTGCGGGCTTTGCTTATTCTCACCTGCTATCTGATA
ACACGGAGTATTACATGGCTATTGATATGTTCCTGAAAGTGGAAGGCGTGACTGGCGAATCTAAAGATGC
TAATCATGCCAGCTGGATCGATGTGCTTTCTTTTAACTGGGGCGCAGCGCAGCCGGGAAATATGGCAGTC
GGCGGTGGCGGCGGTGCCGGTAAAGTTAACTTTCAGGATTTAGCCGTACAGGCCATTGTGGATAAAGGCA
CGCCCGCCATTCTTAAATTCTGTGCCAGCGGTAAGCACGTGAATAAGGTGGAGCTTTCTGTCTGTAAAGC
CGGTGGCCAGCAGGTGGAGTATTCGAAAATTGTTCTTGAAGATGTGCTGGTGACCCGCACGGAATTCACG
GGCGTTGGGCAGACAGATACGGTTCTTGTGAATTACTACTTCCAGGCTGCGAAAGTCAATTTCCATTACT
GGGAACAGTCAAACCAGGGAACCAAAGGTGCGGAAACTAAAGCCGGTTGGGATATTAAACAGAATAAAGA
ACTCTGA