SecReT6
Effector Protein ID: 565643511
-
SecReT6 ID883
T6SS typeA3
Gene symbol-
Locus tagP262_00058
StrainCronobacter sakazakii CMCC 45402
Repliconchromosome [GenBank: NC_023032] [Browse all T6SS(s) in this replicon]
Location [Strand]39652..40134 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDV5TTY5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.90E-39, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|565643511|ref|YP_008894807.1| hypothetical protein P262_00058 [Cronobacter sakazakii CMCC 45402]
MAIDMFLKVDGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNALIDKSTTAIL
KHCSSGKHLTKVELSVCKAGGQQVEYTRITLEDVLVTSVQYTGADNGDTVGVTYAFQAAKVKQQYWEQTA
TGGKGAETSAGWNIKENKEA
-
Nucleotide Sequence: 483 bp     [Download]
>gi|565643472|ref|NC_023032.1|:39652-40134 Cronobacter sakazakii CMCC 45402, complete genome
ATGGCTATTGATATGTTCCTGAAAGTAGACGGTGTAACCGGCGAATCTAAAGATTCCAACCACACCGGCT
GGACCGACATCACCTCTTTTTCCTGGGGCGCATCCCAGCCGGGTAATATGAGCGTGGGCGGCGGTGGCGG
TGCCGGTAAAGTGAATTTCAACGATCTGCACGTTAACGCGCTGATCGACAAATCCACCACCGCTATCCTG
AAGCACTGCTCCAGCGGTAAGCACCTGACCAAAGTTGAGCTGTCTGTCTGCAAAGCGGGCGGCCAGCAGG
TGGAATACACCCGTATCACTCTGGAAGATGTGCTGGTGACCTCCGTTCAGTACACCGGTGCTGACAACGG
CGACACCGTTGGCGTTACTTATGCATTCCAGGCTGCGAAAGTGAAACAGCAGTACTGGGAGCAGACGGCG
ACCGGCGGTAAAGGCGCAGAAACCAGCGCTGGCTGGAACATCAAAGAAAACAAAGAAGCGTAA