SecReT6
Effector Protein ID: 565643534
-
SecReT6 ID883
T6SS typeA3
Gene symbol-
Locus tagP262_00101
StrainCronobacter sakazakii CMCC 45402
Repliconchromosome [GenBank: NC_023032] [Browse all T6SS(s) in this replicon]
Location [Strand]68455..72879 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorECL_01567
DescriptionrhsA
UniProt IDV5TUQ6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 1.10E-67, Aligned region: 349..363
RHS_repeat [PF05593], Evalue: 1.10E-67, Aligned region: 433..445
RHS_repeat [PF05593], Evalue: 1.10E-67, Aligned region: 483..510
RHS_repeat [PF05593], Evalue: 1.10E-67, Aligned region: 555..578
RHS_repeat [PF05593], Evalue: 1.10E-67, Aligned region: 570..591
RHS_repeat [PF05593], Evalue: 1.10E-67, Aligned region: 591..627
RHS_repeat [PF05593], Evalue: 1.10E-67, Aligned region: 643..657
RHS_repeat [PF05593], Evalue: 1.10E-67, Aligned region: 655..691
RHS_repeat [PF05593], Evalue: 1.10E-67, Aligned region: 697..733
RHS_repeat [PF05593], Evalue: 1.10E-67, Aligned region: 722..753
RHS_repeat [PF05593], Evalue: 1.10E-67, Aligned region: 760..797
RHS_repeat [PF05593], Evalue: 1.10E-67, Aligned region: 802..855
RHS_repeat [PF05593], Evalue: 1.10E-67, Aligned region: 869..895
RHS_repeat [PF05593], Evalue: 1.10E-67, Aligned region: 921..956
RHS_repeat [PF05593], Evalue: 1.10E-67, Aligned region: 965..994
RHS_repeat [PF05593], Evalue: 1.10E-67, Aligned region: 1003..1040
RHS_repeat [PF05593], Evalue: 1.10E-67, Aligned region: 1056..1084
RHS_repeat [PF05593], Evalue: 1.10E-67, Aligned region: 1107..1136
RHS_repeat [PF05593], Evalue: 1.10E-67, Aligned region: 1151..1166
Tox-GHH [PF15636], Evalue: 6.20E-20, Aligned region: 1348..1429
PAAR_motif [PF05488], Evalue: 9.80E-16, Aligned region: 3..15
PAAR_motif [PF05488], Evalue: 9.80E-16, Aligned region: 102..130
PAAR_motif [PF05488], Evalue: 9.80E-16, Aligned region: 100..220
RHS [PF03527], Evalue: 1.30E-12, Aligned region: 348..357
RHS [PF03527], Evalue: 1.30E-12, Aligned region: 737..753
RHS [PF03527], Evalue: 1.30E-12, Aligned region: 920..933
RHS [PF03527], Evalue: 1.30E-12, Aligned region: 989..1012
RHS [PF03527], Evalue: 1.30E-12, Aligned region: 1117..1128
RHS [PF03527], Evalue: 1.30E-12, Aligned region: 1223..1260
DUF4150 [PF13665], Evalue: 0.0011, Aligned region: 107..124
DUF4150 [PF13665], Evalue: 0.0011, Aligned region: 179..215
DUF4595 [PF15283], Evalue: 0.0012, Aligned region: 463..508
DUF4595 [PF15283], Evalue: 0.0012, Aligned region: 557..599
DUF4595 [PF15283], Evalue: 0.0012, Aligned region: 697..734
DUF4595 [PF15283], Evalue: 0.0012, Aligned region: 773..796
DUF4595 [PF15283], Evalue: 0.0012, Aligned region: 849..890
Protein Sequence: 1474 a.a.     [Download]
>gi|565643534|ref|YP_008894830.1| hypothetical protein P262_00101 [Cronobacter sakazakii CMCC 45402]
MSDKHAARQGDKIIHSSIFADITSLVAEGLAYAAIGSAVAVAATAAAPLAGAGAAAAGLAAIGSSCALSG
IIGGILANAAGITDDISNMATGIGNAIFPPSPAGTIATGSANVLTNKLPAARAAGKLTPGDTPPPEPQKP
GSFADYGGMLLSAAAQFGSEMWQPTVATAAPGTSSLELDTVLCDKHSGPQYLAEGSKSVFINGQPAVRAK
DRTTCEATISDDVSPNVIIGGETLTVRDIKSGKTAGLAVAMIALSLIRGRPGNILKNMPCALVSAGAGML
TDMAINAVFASSHPVHAATGVKVLNDNNELDFSLPGRFPLRWQRSYNSLTTREGLFGLGWATAFDSYLTL
EDGEVTWFDETGRELRFTLPPLNQALYSISEGLIVRRNENGDVAIADDDGAVWRLFKPTRANPSVLRLAS
LSDEYGNALETGWDEHGRLVRIHDAPCAIDVTLRYEDKRFAQRVTSAVHFDGEREWPLVTYRYDGRGQLA
AVTDAAGITTREYRYNDAGLMIWHRLPGGLESEYRWEKFDHWRVVENRTSTGDGCRIAYDLAAGLTTVTQ
YDGQTRQHYWNAQGLITRFVDERGESWRYEWNEHDLLTRRIDPLGNATTFAYDDMGNRVQEVDAEGNIRA
TQWLEHRALPAAITEADGTATRFYYDEHHGLARIVDALGQTTLLRRDESGQIVEEVDAAGNSRHQEYNDA
GQVIRATDCSGRVTRYRYHPLGWLSTVITADGEETRYHYDAAGRPIQLERPEGWEERLLWNARGLPEAHE
GADGKRNEFTYDTAGRLVSTSNPQGDTVRRRWDSRGRLIALENEKGEAYQFRWGADSRLLEEESLDGVIT
RYGYDACGRTIARTFAAGHPEAITHTFAWSAAGQLLSRTTPEGQTRYDYTPAGLISRIALHASLAENVWS
REAEQELRFEYDALGRVIGEQSENGALGWTYDALGNRTSVQLPDGRMLKHHFYGSGHLLSIALDNLPVTD
FTRDELHRELSRTQGLLTSRSEYDRLGRLTRRDVFAGDAQRPAPRRWSRRWDYDYRNNLIREERDDNPFS
WYRWKYDSAGRLLTQDGTLPGQEQWQWDAAGNPLDDSATQTVRFNRVTQLNGIQWRYDIHGRTVEKDNGQ
TRWRYRYDGEHRLTDVISQPRDRSKPQVEVSFRYDPLGRRISKTRRQFLAGQPTGKAVTTRFVWEGFRLL
QEIHDGVPLTYVYSDPHSYEPLARIDGTQSPDIYWFHNQPNGTPERLTDVEGRVRWEGRNSAWGKLAHES
TPLPTGYHQNLRMQGQYLDRETGLHYNLFRYYDPDCGRFTQHDPIGLAGGINLYQFAPNALGWVDPWGLN
AEDLIRYKPHDSLSAQGGARSSAIARAWVQEKALLQNGGVGSRNWTEQEKELILKTPNSKLTSVMSRAGY
TGHHINSVEGNGTLGYKWQGDPRNIVFLKNHNHPDDFNEHVHGTQGHRGNTQNTTRGRLIDRVKSLTSRQ
RCKE
-
Nucleotide Sequence: 4425 bp     [Download]
>gi|565643472|ref|NC_023032.1|:68455-72879 Cronobacter sakazakii CMCC 45402, complete genome
ATGAGCGACAAACATGCGGCCCGCCAGGGCGACAAGATTATCCACTCCAGTATCTTTGCCGATATCACAA
GCCTTGTGGCTGAAGGTCTCGCGTATGCAGCCATTGGCTCGGCGGTAGCAGTGGCCGCAACGGCTGCCGC
ACCGCTTGCGGGTGCGGGCGCTGCGGCGGCGGGGCTGGCGGCGATAGGTTCCAGCTGCGCGCTGAGCGGA
ATTATCGGTGGTATCCTGGCGAACGCCGCAGGGATCACGGATGACATCAGTAATATGGCGACGGGGATCG
GCAATGCGATTTTCCCGCCATCACCGGCCGGGACAATCGCTACCGGCTCTGCCAATGTGCTGACCAACAA
GCTTCCGGCCGCTCGCGCGGCAGGCAAACTTACGCCAGGCGACACGCCGCCGCCGGAGCCGCAAAAGCCT
GGCAGTTTCGCCGACTACGGCGGTATGTTGCTTTCCGCAGCGGCGCAGTTCGGCAGCGAGATGTGGCAGC
CTACGGTCGCGACTGCCGCGCCAGGGACATCGTCGCTGGAGCTGGATACCGTGCTGTGCGATAAACACTC
CGGCCCGCAATACCTGGCGGAAGGATCAAAAAGCGTCTTCATTAACGGCCAGCCTGCCGTGCGCGCCAAA
GATCGCACCACCTGCGAAGCCACTATTTCGGACGACGTGTCGCCAAACGTCATTATCGGCGGTGAAACGC
TGACGGTGCGCGATATCAAAAGCGGTAAAACCGCAGGGCTGGCGGTAGCGATGATTGCCCTTTCGCTCAT
TCGAGGACGTCCGGGCAACATTCTCAAAAATATGCCCTGCGCTTTAGTGTCGGCAGGCGCCGGTATGCTT
ACGGATATGGCGATAAACGCCGTTTTCGCCTCCTCCCACCCCGTTCATGCCGCCACCGGCGTGAAGGTTC
TGAACGATAATAATGAACTGGACTTCTCACTGCCTGGTCGTTTTCCCCTTCGCTGGCAGCGCAGCTATAA
CAGCTTAACCACCCGCGAAGGATTGTTCGGCCTGGGCTGGGCTACCGCTTTTGACAGCTATCTGACGCTG
GAAGATGGCGAAGTCACCTGGTTTGACGAGACTGGCCGTGAGTTGCGCTTTACACTGCCACCGCTGAACC
AGGCGCTTTACAGTATCAGCGAAGGGCTTATTGTTCGCCGTAATGAGAACGGCGATGTGGCGATCGCCGA
TGACGACGGCGCCGTCTGGCGCTTATTTAAACCCACACGCGCCAACCCTTCAGTGCTGCGCCTTGCATCG
CTAAGTGATGAATATGGCAATGCGCTGGAAACCGGCTGGGATGAACATGGCCGTCTGGTGCGCATTCACG
ACGCGCCTTGCGCCATTGATGTCACGCTGCGCTATGAGGATAAACGCTTTGCGCAGCGTGTGACGTCAGC
CGTGCATTTCGATGGTGAAAGAGAATGGCCGCTGGTCACTTATCGTTACGACGGTCGTGGGCAACTGGCG
GCAGTCACCGACGCAGCCGGCATCACGACGCGTGAGTACCGCTACAACGATGCTGGCCTGATGATCTGGC
ACCGGTTACCCGGCGGGCTGGAGAGTGAATATCGCTGGGAGAAATTCGATCACTGGCGCGTGGTGGAAAA
CCGCACCAGTACCGGCGATGGCTGCCGTATCGCTTACGATCTGGCGGCGGGGCTGACGACGGTCACGCAA
TACGACGGCCAGACGCGCCAGCATTACTGGAACGCGCAGGGGCTTATCACGCGTTTTGTTGACGAACGTG
GTGAGAGCTGGCGTTACGAGTGGAATGAACACGATCTGCTGACCCGCCGTATCGACCCACTGGGTAACGC
GACCACCTTTGCCTATGACGACATGGGCAACCGGGTGCAGGAAGTGGATGCTGAAGGCAACATCCGCGCC
ACGCAGTGGCTGGAGCACCGCGCCTTGCCTGCGGCTATCACCGAGGCAGACGGTACCGCCACGCGTTTTT
ATTACGATGAACATCACGGGCTGGCGCGCATCGTCGATGCGCTCGGGCAAACCACACTGTTGCGCCGCGA
CGAGTCTGGACAAATCGTGGAAGAGGTGGATGCGGCGGGTAACAGCCGCCACCAGGAATACAACGACGCG
GGGCAGGTTATTCGCGCGACAGACTGTTCCGGGCGCGTTACCCGTTACCGCTATCACCCGCTCGGTTGGT
TAAGTACTGTTATTACAGCGGATGGTGAAGAGACCCGCTATCACTACGACGCCGCGGGCCGTCCGATCCA
GCTGGAGCGCCCCGAAGGCTGGGAAGAACGCCTGTTATGGAATGCGCGCGGTCTGCCTGAGGCGCATGAA
GGGGCTGACGGCAAGCGCAACGAATTTACCTATGATACTGCGGGGCGTCTTGTTTCGACCTCTAACCCGC
AGGGGGATACCGTGCGCCGCCGCTGGGACAGCCGTGGCCGCCTGATTGCACTCGAAAATGAAAAAGGCGA
GGCATACCAGTTCCGCTGGGGCGCGGATTCCCGGCTGCTGGAGGAAGAGAGTTTAGATGGCGTGATTACC
CGCTACGGGTATGACGCCTGCGGACGCACCATCGCTCGTACTTTCGCCGCCGGGCATCCTGAGGCGATTA
CCCATACTTTCGCCTGGAGCGCGGCCGGGCAGCTTCTTTCACGCACGACGCCGGAAGGCCAGACCCGCTA
CGACTACACGCCAGCAGGGTTAATCAGCCGTATCGCACTGCATGCTTCGCTTGCGGAAAACGTCTGGAGC
CGCGAGGCGGAACAGGAGCTGCGCTTTGAGTATGACGCCCTGGGCCGCGTCATCGGCGAGCAGAGCGAAA
ACGGCGCGCTGGGCTGGACCTACGATGCGCTCGGCAACCGCACTTCTGTGCAACTACCCGACGGGCGAAT
GCTGAAACACCACTTCTACGGCAGCGGTCATCTGTTGTCCATTGCGCTCGATAACCTGCCGGTCACGGAT
TTTACCCGCGATGAACTGCACCGCGAGCTGAGCCGTACACAGGGGTTACTCACGAGCCGCAGCGAGTATG
ACCGGCTGGGCCGCCTGACGAGGCGCGATGTTTTCGCCGGCGACGCGCAACGCCCCGCGCCGCGCCGCTG
GTCTCGCCGCTGGGATTATGATTATCGCAACAACCTCATCCGCGAGGAGCGCGACGATAACCCCTTCAGC
TGGTACCGCTGGAAATATGACAGCGCAGGGCGTCTGCTGACGCAGGACGGCACGCTGCCGGGCCAGGAAC
AGTGGCAGTGGGACGCGGCGGGCAATCCGCTTGACGACAGCGCGACGCAGACGGTGCGCTTTAACCGCGT
GACGCAGCTTAACGGCATCCAGTGGCGTTATGACATTCATGGCCGCACGGTAGAGAAAGATAACGGGCAG
ACCCGCTGGCGCTACCGCTACGACGGCGAACACCGTCTGACGGACGTTATCAGCCAGCCACGGGACCGCA
GTAAGCCGCAGGTGGAGGTGAGCTTCCGTTACGATCCGCTGGGGCGGCGCATCAGCAAGACCCGCCGTCA
GTTTCTGGCGGGGCAGCCCACCGGTAAAGCGGTCACCACGCGCTTTGTCTGGGAAGGGTTCCGGTTGCTA
CAGGAAATCCATGACGGGGTACCGCTCACCTACGTTTACAGCGACCCGCACAGCTACGAGCCGCTGGCGC
GCATCGACGGCACGCAGTCCCCGGACATTTACTGGTTCCACAACCAGCCGAACGGCACGCCGGAGCGGCT
GACCGATGTGGAAGGCCGGGTGCGCTGGGAAGGGCGAAACAGCGCGTGGGGCAAACTGGCGCACGAGTCG
ACGCCGTTGCCGACGGGCTATCACCAGAACCTGCGGATGCAGGGGCAGTACCTGGACCGTGAAACCGGGC
TTCACTACAATTTATTCCGTTATTATGACCCGGACTGCGGCAGGTTCACGCAGCATGACCCGATAGGCCT
GGCGGGCGGTATCAATCTGTACCAGTTTGCGCCGAATGCGCTGGGGTGGGTGGATCCGTGGGGGTTGAAT
GCAGAAGATTTAATACGTTATAAACCGCATGATTCTTTGAGTGCTCAAGGAGGAGCCAGAAGCTCAGCGA
TAGCTCGCGCTTGGGTTCAGGAAAAAGCCTTGTTACAAAATGGCGGAGTGGGTTCTCGTAATTGGACGGA
ACAGGAAAAAGAGTTAATTTTGAAAACGCCTAACAGTAAACTTACTTCCGTGATGTCACGTGCAGGTTAC
ACAGGGCATCATATCAACTCTGTTGAAGGAAATGGAACTCTTGGCTATAAATGGCAAGGAGATCCCAGAA
ATATAGTATTTCTGAAAAACCATAATCACCCTGATGATTTCAATGAACATGTACATGGAACACAGGGGCA
CAGAGGTAATACACAAAATACAACTCGTGGTCGTTTGATTGATAGAGTGAAAAGTTTAACAAGTAGACAA
CGTTGCAAAGAATAA