SecReT6
Effector Protein ID: 568128389
-
SecReT6 ID884
T6SS typeA4b
Gene symbol-
Locus tagAX27061_3274
StrainAchromobacter xylosoxidans NBRC 15126 = ATCC 27061
Repliconchromosome [GenBank: NC_023061] [Browse all T6SS(s) in this replicon]
Location [Strand]3595555..3596058 [-]
ProductUncharacterized protein ImpD
Effector typeProtein
Homologous effectorBCAL0343
DescriptionHcp protein
UniProt IDV9RV18
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-41, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|568128389|ref|YP_008925036.1| Uncharacterized protein ImpD [Achromobacter xylosoxidans NBRC 15126 = ATCC 27061]
MKDIYVKFGNPALKGESQDKDHPDWIEVGSWRHEIIQPRSATASTSGGHTAERTEHGEMVFTKDLDVVSP
LLYQHASGGTTFDEVTIDFLRADGEGNRVKYLEIKLKYVIISRVAPEVVSEGLPHESFSLKYAAVQWKYT
QQKVGGNQGGNSQGAWSLTKNDKTYSV
-
Nucleotide Sequence: 504 bp     [Download]
>gi|568125122|ref|NC_023061.1|:c3596058-3595555 Achromobacter xylosoxidans NBRC 15126 = ATCC 27061, complete genome
ATGAAGGACATCTACGTCAAATTCGGCAATCCCGCGCTCAAGGGCGAGTCCCAGGACAAGGATCACCCGG
ACTGGATCGAAGTGGGCTCGTGGCGCCACGAGATCATCCAGCCGCGGTCGGCCACCGCCTCGACCTCGGG
CGGCCACACCGCCGAGCGCACCGAGCATGGCGAAATGGTCTTCACCAAGGACCTGGACGTGGTCAGCCCG
CTGCTCTACCAGCACGCTTCGGGCGGCACGACCTTTGACGAAGTGACCATCGACTTCCTGCGCGCCGACG
GCGAAGGCAACCGCGTCAAGTACCTGGAAATCAAGCTCAAGTACGTGATCATCTCGCGCGTCGCGCCGGA
AGTGGTCAGCGAAGGCCTGCCGCACGAATCGTTCTCGCTGAAGTACGCCGCGGTCCAGTGGAAGTACACG
CAGCAGAAGGTCGGCGGCAACCAGGGCGGCAATTCCCAGGGCGCCTGGAGCCTGACCAAGAACGACAAGA
CCTACTCGGTCTGA