SecReT6
Effector Protein ID: 568140732
-
SecReT6 ID885
T6SS typeA1
Gene symbol-
Locus tagU771_18945
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]4171892..4172407 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDV9QY90
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-38, Aligned region: 6..155
Protein Sequence: 171 a.a.     [Download]
>gi|568140732|ref|YP_008933317.1| hypothetical protein U771_18945 [Pseudomonas sp. TKP]
MPTPAYLSITGVKQGLITAGTFTQDSVGGIYQEGHEDQILVQAFAHQVIIPRDPQSGQPTGQRVHKPLMI
SKVFDKSSPLLFSALTSGEEVKCRLEWLRTSAAGTQEHYFTIELEGATIVDIQSRMPNCQDPDNAHFTHL
EDVYFSYRKITWTHEVSGTSGSDDWRSPAAG
-
Nucleotide Sequence: 516 bp     [Download]
>gi|568136993|ref|NC_023064.1|:4171892-4172407 Pseudomonas sp. TKP, complete genome
ATGCCAACACCCGCGTATCTTTCTATTACCGGTGTCAAGCAAGGTTTGATAACGGCAGGCACTTTTACCC
AGGACTCGGTAGGTGGCATTTACCAGGAAGGTCATGAGGACCAGATTCTCGTGCAGGCGTTTGCTCACCA
GGTAATCATTCCCCGCGACCCGCAATCGGGCCAACCGACGGGGCAGAGGGTGCATAAACCGTTGATGATC
AGCAAGGTCTTCGACAAGTCATCGCCATTGCTCTTCAGCGCCCTCACCAGCGGCGAAGAGGTCAAGTGCC
GACTGGAGTGGCTGCGGACCTCAGCGGCAGGCACGCAGGAGCACTACTTCACCATCGAACTCGAAGGGGC
GACCATCGTCGACATCCAGTCGCGCATGCCCAATTGCCAGGACCCGGACAACGCGCATTTCACCCACCTC
GAAGACGTCTACTTCAGCTATCGCAAGATCACTTGGACCCATGAGGTCTCCGGTACATCCGGCTCGGACG
ACTGGCGCAGCCCGGCGGCCGGCTGA