SecReT6
Effector Protein ID: 568151271
-
SecReT6 ID887
T6SS typeA3
Gene symbol-
Locus tagT223_00440
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]102430..102918 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA0085
DescriptionHcp protein
UniProt IDV9SY43
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.80E-46, Aligned region: 6..137
Protein Sequence: 162 a.a.     [Download]
>gi|568151271|ref|YP_008940216.1| hypothetical protein T223_00440 [Pseudomonas aeruginosa LES431]
MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGGGGAGKVNVQDLSFTKYIDKSTPNLM
MACSSGKHYPQAKLTIRKAGGENQVEYLIITLKEVLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQK
ADGAKDGGPVKYGWNIRQNVQA
-
Nucleotide Sequence: 489 bp     [Download]
>gi|568151185|ref|NC_023066.1|:102430-102918 Pseudomonas aeruginosa LES431, complete genome
ATGGCTGTTGATATGTTCATCAAGATCGGCGACGTCAAGGGTGAGTCCAAGGACAAGACTCACGCCGAGG
AAATCGACGTGCTGGCATGGAGCTGGGGCATGTCCCAGTCCGGGTCGATGCACATGGGCGGTGGCGGCGG
CGCCGGCAAGGTCAACGTGCAGGACCTGTCGTTCACCAAGTACATCGACAAGTCCACGCCCAACCTGATG
ATGGCCTGCTCCAGCGGCAAGCACTATCCGCAGGCGAAGCTGACCATCCGCAAGGCCGGCGGCGAGAACC
AGGTCGAGTACCTGATCATCACCCTGAAGGAAGTCCTGGTGTCCTCGGTGAGCACCGGCGGCAGCGGTGG
CGAGGATCGCCTGACCGAGAACGTGACCCTGAACTTCGCCCAGGTCCAGGTCGACTACCAGCCGCAGAAG
GCGGATGGCGCGAAGGACGGCGGTCCGGTCAAGTACGGCTGGAACATCCGCCAGAACGTGCAGGCCTGA