SecReT6
Effector Protein ID: 568154627
-
SecReT6 ID887
T6SS typeA3
Gene symbol-
Locus tagT223_17785
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]3810976..3811440 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA1844
DescriptionTse1
UniProt IDV9TC25
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 0.00025, Aligned region: 29..97
CHAP [PF05257], Evalue: 0.00025, Aligned region: 103..130
NLPC_P60 [PF00877], Evalue: 0.0012, Aligned region: 23..98
NLPC_P60 [PF00877], Evalue: 0.0012, Aligned region: 134..153
Protein Sequence: 154 a.a.     [Download]
>gi|568154627|ref|YP_008943609.1| hypothetical protein T223_17785 [Pseudomonas aeruginosa LES431]
MDSLDQCIVNACKNSWDKSYLAGTPNKDNCSGFVQSVAAELGVPMPRGNANAMVDGLEQSWTKLASGAEA
AQKAAQGFLVIAGLKGRTYGHVAVVISGPLYRQKYPMCWCGSIAGAVGQSQGLKSVGQVWNRTDRDRLNY
YVYSLASCSLPRAS
-
Nucleotide Sequence: 465 bp     [Download]
>gi|568151185|ref|NC_023066.1|:3810976-3811440 Pseudomonas aeruginosa LES431, complete genome
ATGGACAGTCTCGATCAATGCATCGTCAACGCCTGCAAGAACAGCTGGGACAAGAGCTACCTGGCCGGCA
CCCCGAACAAGGACAACTGTTCCGGCTTCGTCCAGTCGGTGGCCGCCGAGCTGGGCGTACCGATGCCCCG
CGGCAACGCCAACGCCATGGTCGACGGCCTGGAGCAGAGCTGGACCAAGCTCGCCTCCGGCGCCGAGGCC
GCGCAGAAGGCGGCCCAGGGCTTCCTGGTGATCGCCGGCCTGAAGGGCCGCACCTACGGGCACGTCGCGG
TGGTCATCAGCGGTCCGCTGTATCGGCAGAAGTACCCGATGTGCTGGTGCGGCAGCATCGCCGGCGCGGT
CGGCCAGAGCCAGGGCCTGAAGTCGGTCGGCCAGGTATGGAATCGCACCGACCGCGACCGCCTCAACTAC
TACGTCTACTCCCTGGCCAGTTGCAGCCTGCCCAGGGCCAGTTGA