SecReT6
Effector Protein ID: 568156613
-
SecReT6 ID888
T6SS typeA4a
Gene symbol-
Locus tagT223_28015
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]6010228..6012465 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA5089
DescriptionPldB
UniProt IDV9TDU8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam PLDc [PF00614], Evalue: 1.20E-06, Aligned region: 303..329
PLDc [PF00614], Evalue: 1.20E-06, Aligned region: 640..661
PLDc_2 [PF13091], Evalue: 1.50E-06, Aligned region: 56..117
PLDc_2 [PF13091], Evalue: 1.50E-06, Aligned region: 281..332
PLDc_2 [PF13091], Evalue: 1.50E-06, Aligned region: 433..466
PLDc_2 [PF13091], Evalue: 1.50E-06, Aligned region: 635..687
Protein Sequence: 745 a.a.     [Download]
>gi|568156613|ref|YP_008945605.1| hypothetical protein T223_28015 [Pseudomonas aeruginosa LES431]
MSDLYKPQTLKLYAQQAGSVRLTLDWFANKAFYPPRAGVHIKPLINGQAAFDAVHAAMEAARHSIDIITW
GFDPAMRFKRPDGPRIGELLQTKGREGVQARVLVWSNQLARLKENTIPGAGVGGSGGTWAGSGVASGSAV
DNEVLRLEQRRQHNLNLIARQQEALERSERLHREGRLPSFDPRGAAHARARIAELEAENAEIQRTLDSSE
AQGYGGKRGSGGTRQDPWGQIFTRDWFKAVRGGGLQNVEFRTRDFEQTARPVMNGEQVRLVNGRLQSLIH
LLRADGIDDLGIGQLLVLTQFASHHQKMVLVDYGSPQAIGFVMGHNMHRNYWDTSAHLFDDRAAGRDPGF
GPWQDISMQVQGPVLADLSRNFSEAWDLETPWYKRWFSTPSLTAERDALPLPKIATPASNSVAQICRTQP
QDDERSILEHYLKALGNATDYVYMENQYFRYAGFAERLRKTAQVRKARGVPGDLYLFVVTNTPDSSDASK
TTYDMMKGLGQEQLMPQVQRDLAHDLREKREQLKQVRENLHPDPYVRRGQENNIERLERKIEALEEKGVT
PEVEQRLGDLGAQEIPGLAKNTGEDDKPYQLAEVPGLKVVVATLATSDPAPGSPPPARLSAEAEAALGAP
PLKARYKHIYVHSKLLLVDDLYTLLSSANINVRSMHGDSELGIAQPNPDLARAMREELWGLHAYEVAATT
KDNFELWNQTMDKNWKQQRNDEPLTSHLLRFWDVITPYSPSFTVD
-
Nucleotide Sequence: 2238 bp     [Download]
>gi|568151185|ref|NC_023066.1|:c6012465-6010228 Pseudomonas aeruginosa LES431, complete genome
ATGAGCGACCTGTACAAACCGCAGACCCTCAAGCTATACGCGCAACAGGCCGGCAGCGTCCGGCTGACCC
TCGACTGGTTCGCCAACAAGGCCTTCTACCCGCCGCGCGCGGGTGTGCACATCAAGCCGCTGATCAATGG
CCAGGCGGCCTTCGACGCGGTGCATGCGGCGATGGAAGCGGCCCGGCACAGCATCGACATCATCACCTGG
GGCTTCGACCCGGCCATGCGCTTCAAACGCCCCGACGGACCGCGAATCGGCGAATTGCTGCAGACGAAGG
GCCGCGAAGGAGTGCAGGCGCGAGTGCTGGTCTGGAGCAACCAACTCGCCAGGCTCAAGGAAAACACCAT
CCCCGGGGCCGGCGTCGGCGGTTCCGGCGGCACCTGGGCGGGCTCGGGCGTCGCCAGCGGCAGCGCGGTG
GACAACGAGGTGCTGCGACTGGAGCAGCGGCGCCAGCATAACCTCAACCTCATCGCGCGGCAGCAGGAAG
CCCTGGAGCGCTCGGAACGGCTGCACCGCGAAGGCAGGCTGCCGAGCTTCGACCCGCGGGGCGCCGCCCA
CGCGCGGGCGCGCATCGCCGAGCTGGAGGCGGAGAACGCCGAGATCCAGCGCACTCTCGACAGCAGCGAG
GCCCAGGGCTACGGCGGCAAGCGCGGTTCCGGCGGCACCCGCCAGGATCCCTGGGGGCAGATATTCACCC
GCGACTGGTTCAAGGCGGTACGCGGCGGTGGGTTGCAGAACGTCGAGTTCCGTACCCGCGACTTCGAGCA
GACGGCCAGGCCGGTGATGAACGGCGAGCAGGTACGCCTCGTCAATGGGCGACTGCAAAGCCTGATCCAC
CTGCTGCGCGCCGATGGCATCGACGACCTGGGCATCGGCCAGTTGCTGGTACTCACCCAGTTCGCCAGCC
ATCACCAGAAGATGGTCCTGGTCGACTATGGCAGCCCGCAGGCCATCGGCTTCGTCATGGGTCACAACAT
GCACCGCAACTACTGGGACACCAGCGCCCACCTGTTCGACGACCGCGCCGCCGGTCGCGATCCCGGGTTC
GGGCCCTGGCAGGATATCTCCATGCAGGTCCAGGGCCCGGTGCTGGCCGACCTCAGCCGCAACTTCAGCG
AGGCCTGGGACCTCGAGACGCCGTGGTACAAGCGCTGGTTCTCGACGCCATCGCTGACCGCCGAGCGCGA
CGCCTTGCCGCTGCCGAAGATCGCCACGCCCGCCAGCAACAGCGTCGCGCAGATTTGCCGGACCCAGCCG
CAGGACGACGAGCGCTCGATCCTGGAGCACTATCTCAAGGCCCTGGGCAATGCCACCGACTACGTCTACA
TGGAAAACCAGTACTTCCGTTATGCCGGCTTCGCCGAGCGCCTGCGGAAGACTGCGCAGGTGCGCAAGGC
CCGGGGCGTGCCCGGCGACCTGTACCTGTTCGTCGTGACCAACACCCCCGACTCCAGCGACGCCTCGAAG
ACCACCTACGACATGATGAAAGGCCTGGGCCAGGAGCAACTGATGCCGCAGGTACAGCGCGACCTGGCGC
ATGACTTGCGGGAAAAGCGGGAGCAGTTGAAGCAGGTCAGGGAAAACCTACATCCCGATCCCTATGTCCG
GCGCGGCCAGGAAAACAACATCGAACGGCTGGAGCGCAAGATCGAGGCGCTCGAAGAGAAAGGCGTGACG
CCGGAAGTCGAGCAACGCCTCGGCGATCTCGGCGCGCAGGAGATTCCCGGACTGGCGAAGAACACCGGCG
AGGACGACAAGCCCTATCAACTCGCCGAAGTACCCGGCCTCAAGGTGGTCGTCGCCACCCTGGCCACCAG
CGACCCTGCCCCCGGCAGCCCGCCGCCAGCGCGCCTGTCCGCCGAAGCCGAGGCCGCCCTCGGGGCACCG
CCGCTGAAGGCGCGCTACAAGCACATCTACGTGCACTCCAAGCTGCTGCTGGTGGACGACCTCTATACCC
TGCTCAGCTCGGCCAATATCAATGTCCGCAGCATGCATGGCGACAGCGAGTTGGGGATTGCCCAGCCCAA
TCCGGATTTGGCGAGGGCGATGCGGGAGGAGTTGTGGGGACTACATGCGTATGAAGTGGCTGCAACAACC
AAGGACAACTTTGAACTTTGGAATCAAACAATGGACAAGAACTGGAAACAGCAGCGAAACGATGAACCTC
TCACTAGCCATCTATTACGGTTCTGGGATGTCATAACACCTTATAGCCCGAGCTTTACGGTGGATTAA