SecReT6
Effector Protein ID: 568187784
-
SecReT6 ID891
T6SS typeA4b
Gene symbol-
Locus tagX970_13275
StrainPseudomonas monteilii SB3101
Repliconchromosome [GenBank: NC_023076] [Browse all T6SS(s) in this replicon]
Location [Strand]2786396..2786914 [+]
ProductHcp1 family type VI secretion system effector
Effector typeProtein
Homologous effectorPsyr_4965
DescriptionHcp protein
UniProt IDV9V078
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.20E-41, Aligned region: 6..146
Protein Sequence: 172 a.a.     [Download]
>gi|568187784|ref|YP_008960397.1| Hcp1 family type VI secretion system effector [Pseudomonas monteilii SB3101]
MAFDAYIQIDGIPGEVLDAKHKDWIEVLGYEYGATQATSATASSSGGASSERVALSDFKIRKAVDKASAK
LFEHCCTGKHIAKLKLNVNRAGGDKVTYLTIDMEEVVVSSVRFIAGGNQNGEDKAVSDLPVEEISFNFAR
IKTTYTQQNRTDGQAGGNIVGGWDRTANKVFA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|568185322|ref|NC_023076.1|:2786396-2786914 Pseudomonas monteilii SB3101, complete genome
ATGGCATTTGACGCGTATATCCAAATCGACGGCATCCCGGGCGAAGTACTGGATGCAAAGCACAAGGACT
GGATCGAAGTGCTGGGCTACGAGTACGGCGCCACCCAGGCCACCTCGGCTACCGCCAGCTCCTCGGGCGG
TGCGTCGTCCGAGCGTGTTGCCCTGAGCGACTTCAAGATCCGCAAGGCGGTCGACAAGGCTTCGGCCAAG
CTGTTCGAACACTGCTGCACCGGCAAGCACATCGCCAAGCTGAAGCTGAACGTGAACCGCGCCGGTGGTG
ACAAGGTCACCTACCTGACCATCGACATGGAAGAAGTCGTGGTGTCCTCGGTGCGCTTCATCGCCGGTGG
CAACCAGAACGGTGAAGACAAGGCTGTGAGCGACCTGCCCGTCGAAGAAATCAGCTTCAACTTCGCCCGC
ATCAAGACCACCTACACCCAGCAGAACCGCACCGACGGCCAGGCTGGCGGCAACATCGTCGGCGGCTGGG
ACCGCACCGCGAACAAAGTGTTTGCCTGA