SecReT6
Effector Protein ID: 568306832
-
SecReT6 ID893
T6SS typeA3
Gene symbol-
Locus tagSCV20265_0093
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]111165..113105 [+]
ProductVgrG protein
Effector typeProtein
Homologous effectorPA0091
Descriptiontype VI secretion system Vgr family protein
UniProt IDV9TVN8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.90E-88, Aligned region: 29..329
Phage_base_V [PF04717], Evalue: 2.00E-26, Aligned region: 369..462
Protein Sequence: 646 a.a.     [Download]
>gi|568306832|ref|YP_008979101.1| VgrG protein [Pseudomonas aeruginosa SCV20265]
MGLMQLTRLVQVDCPLGPDVLLLQRMEGREELGRLFAYELHLVSENPNLPLEQLLGKPMSLSLELPGGSR
RFFHGIVARCSQVAGHGQFAGYQATLRPWPWLLTRTSDCRIFQNQSVPEIIKQVFRDLGFSDFEDALTRP
YREWEYCVQYRETSFDFISRLMEQEGIYYWFRHEQKRHILVLSDAYGAHRSPGGYASVPYYPPTLGHRER
DHFFDWQMAREVQPGSLTLNDYDFQRPGARLEVRSNIARPHAAADYPLYDYPGEYVQSQDGEQYARNRIE
AIQAQHERVRLRGVVRGIGAGHLFRLSGYPRDDQNREYLVVGAEYRVVQELYETGSGGAGSQFESELDCI
DASQSFRLLPQTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGMKSRSSKGGTPANFNEIRM
EDKKGAEQLYIHAERNQDNLVENDASLSVGHDRNKSIGHDELARIGNNRTRAVKLNDTLLVGGAKSDSVT
GTYLIEAGAQIRLVCGKSVVEFNADGTINISGSAFNLYASGNGNIDTGGRLDLNSGGASEVDAKGKGVQG
TIDGQVQAMFPPPAKG
-
Nucleotide Sequence: 1941 bp     [Download]
>gi|568306739|ref|NC_023149.1|:111165-113105 Pseudomonas aeruginosa SCV20265, complete genome
ATGGGATTGATGCAACTGACCCGCCTGGTCCAGGTGGATTGCCCGCTGGGGCCGGACGTGCTGCTGTTGC
AGCGCATGGAGGGACGCGAGGAACTGGGACGGCTGTTCGCCTACGAGCTGCACCTGGTATCGGAAAATCC
CAACCTGCCGCTGGAGCAGTTGCTCGGCAAGCCGATGAGCCTGTCGCTGGAGCTGCCCGGCGGCAGCCGG
CGCTTCTTTCACGGCATCGTCGCGCGCTGTAGCCAGGTGGCCGGGCACGGCCAGTTCGCCGGCTACCAGG
CCACCCTGCGGCCCTGGCCGTGGCTGCTGACGCGCACCTCGGACTGCCGCATCTTCCAGAACCAGAGCGT
GCCGGAGATCATCAAGCAGGTGTTCCGCGACCTCGGCTTTTCCGATTTCGAGGATGCCCTCACGCGCCCC
TACCGCGAGTGGGAATACTGCGTGCAGTACCGCGAGACCAGCTTCGACTTCATCAGCCGGCTGATGGAAC
AGGAGGGCATCTACTACTGGTTCCGCCATGAGCAGAAGCGCCATATCCTGGTGCTCTCCGACGCCTACGG
CGCGCATCGCAGCCCGGGTGGCTACGCCAGCGTGCCGTACTACCCGCCGACCCTCGGCCATCGCGAGCGC
GACCACTTCTTCGACTGGCAGATGGCACGCGAGGTCCAGCCCGGTTCGCTGACCCTCAACGACTACGACT
TCCAGCGCCCCGGCGCGCGCCTGGAGGTGCGTTCGAACATCGCCCGGCCGCACGCGGCGGCCGACTACCC
GCTGTACGACTATCCCGGCGAATACGTGCAGAGCCAGGACGGCGAGCAGTACGCGCGCAACCGCATCGAG
GCGATCCAGGCGCAGCACGAGCGCGTGCGCCTGCGCGGCGTGGTGCGCGGGATCGGCGCCGGGCACCTGT
TCCGCCTGAGCGGCTATCCGCGCGATGACCAGAACCGCGAGTACCTGGTGGTCGGCGCCGAATACCGGGT
GGTCCAGGAACTCTACGAAACCGGCAGCGGCGGTGCCGGCTCGCAGTTCGAGAGCGAGCTGGACTGCATC
GACGCCAGCCAGTCGTTCCGTCTCCTGCCGCAGACTCCGGTACCGGTGGTGCGGGGTCCGCAGACCGCGG
TGGTGGTCGGACCCAAGGGCGAGGAGATCTGGACCGACCAGTACGGCCGGGTCAAGGTGCACTTCCACTG
GGATCGCCACGACCAGTCGAACGAGAACAGCTCCTGCTGGATTCGCGTGTCCCAGGCCTGGGCCGGGAAG
AACTGGGGTTCGATGCAGATCCCGCGGATCGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCGG
ACCGGCCGATCATCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGC
CACCCAGAGCGGGATGAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATG
GAGGACAAGAAGGGCGCCGAGCAGTTATACATCCACGCCGAGCGCAACCAGGACAACCTGGTCGAGAACG
ATGCCTCGCTGTCGGTCGGCCACGACCGCAACAAGAGCATCGGCCACGACGAGCTGGCGCGCATCGGCAA
CAACCGCACCCGCGCGGTGAAGCTCAACGACACCCTGTTGGTGGGCGGGGCGAAGAGCGACAGCGTCACC
GGCACCTACCTGATCGAGGCCGGCGCGCAGATCCGCCTGGTCTGCGGCAAGAGCGTGGTGGAGTTCAACG
CCGACGGCACCATCAATATCTCCGGCAGCGCCTTCAACCTCTACGCCAGCGGCAACGGCAACATCGACAC
CGGCGGCCGCCTCGACCTCAATTCCGGCGGCGCCAGCGAGGTCGACGCCAAGGGCAAGGGCGTGCAGGGC
ACCATCGACGGCCAGGTACAGGCGATGTTTCCGCCGCCGGCGAAGGGCTGA