SecReT6
Effector Protein ID: 568306834
-
SecReT6 ID893
T6SS typeA3
Gene symbol-
Locus tagSCV20265_0095
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]113501..114793 [-]
ProductRhs family protein
Effector typeProtein
Homologous effectorPA0093
DescriptionTse6
UniProt IDV9TTI6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Toxin_61 [PF15538], Evalue: 3.30E-75, Aligned region: 266..422
PAAR_motif [PF05488], Evalue: 1.10E-14, Aligned region: 4..16
PAAR_motif [PF05488], Evalue: 1.10E-14, Aligned region: 78..153
DUF4150 [PF13665], Evalue: 0.006, Aligned region: 84..104
DUF4150 [PF13665], Evalue: 0.006, Aligned region: 125..146
Protein Sequence: 430 a.a.     [Download]
>gi|568306834|ref|YP_008979103.1| Rhs family protein [Pseudomonas aeruginosa SCV20265]
MDAQAAARLGDEIAHGFGVAAMVAGAVAGALIGAAVVAATAATGGLAAVILAGSIAAGGLSMFQIVKGLT
TIFELPEPTTGVLIRGSFNVYVNSRNAMRAGDDVSATCSGLPLNHPLWPFPVLIAEGSATVYINGKPAAR
LQSKMVCGAHIKTGSQDTFIGGPTERVAFVLDLEEWLHTGLEALGLAALAGGLLLAAMAGVAALAGFVAI
GGLMMGGMALLGDLGDRLGPGYRDLFQGVAGMALLGFGPKLAGRRPAAVTSETAQRRAYLNNKFGRSGNL
DHDINYRGNRETAAKFFKSKDIDPADAESYMNGLDFNHPVRVETLAPGKNLWQYQSPGAPQGNWYTLSPR
VQPTELGINPMGTNRAANTIEPKVLNSYRTTQKVEVLRSTAAPTDDFWSVKGQSYPAKGGAQQLFSNEKG
SFGLLPREGS
-
Nucleotide Sequence: 1293 bp     [Download]
>gi|568306739|ref|NC_023149.1|:c114793-113501 Pseudomonas aeruginosa SCV20265, complete genome
ATGGATGCGCAAGCCGCCGCCCGACTGGGCGATGAGATAGCCCACGGTTTCGGTGTCGCCGCGATGGTCG
CCGGAGCCGTGGCCGGAGCCCTGATCGGCGCCGCCGTGGTCGCCGCCACCGCCGCCACCGGCGGCCTGGC
CGCGGTGATCCTGGCCGGCTCGATCGCCGCCGGCGGGCTGTCGATGTTCCAGATCGTCAAGGGCCTGACC
ACCATCTTCGAGCTACCCGAGCCGACCACCGGGGTGCTCATACGCGGCAGCTTCAACGTCTACGTGAACA
GTCGCAACGCGATGCGCGCCGGCGACGACGTCTCCGCCACCTGCAGCGGCCTGCCGCTGAACCATCCGCT
GTGGCCGTTCCCGGTGCTGATCGCCGAAGGCAGCGCCACCGTGTACATCAACGGCAAGCCGGCGGCGCGC
CTGCAGAGCAAGATGGTCTGCGGCGCGCACATCAAGACCGGCAGCCAGGACACCTTCATCGGCGGCCCCA
CCGAGCGGGTGGCCTTCGTCCTCGACCTGGAGGAATGGCTGCACACCGGCCTCGAGGCGCTGGGCCTGGC
GGCCCTTGCCGGCGGCCTGCTGCTGGCGGCGATGGCCGGGGTCGCGGCGCTGGCCGGCTTCGTCGCCATC
GGCGGGCTGATGATGGGCGGCATGGCCCTGCTCGGCGACCTCGGCGACCGCCTCGGTCCCGGCTACCGCG
ACCTGTTCCAGGGCGTGGCGGGGATGGCATTGCTGGGCTTCGGGCCGAAACTCGCCGGTCGTCGTCCGGC
AGCGGTGACCTCCGAAACCGCGCAACGACGCGCCTACCTGAACAACAAGTTCGGTCGTTCCGGCAACCTC
GACCACGACATCAACTACCGCGGGAATCGTGAAACCGCCGCCAAGTTCTTCAAGTCGAAGGACATCGATC
CTGCCGATGCCGAGTCGTACATGAACGGCCTGGACTTCAACCATCCGGTCCGTGTGGAAACCCTCGCGCC
CGGCAAGAACCTGTGGCAGTACCAGTCCCCCGGAGCGCCGCAGGGCAACTGGTATACACTCAGCCCGCGC
GTGCAGCCCACGGAGCTGGGAATCAACCCCATGGGCACCAACCGGGCGGCGAACACCATCGAACCCAAGG
TCCTCAACTCCTACAGGACGACCCAGAAGGTCGAGGTCCTGCGCAGCACCGCTGCGCCGACCGATGACTT
CTGGTCGGTAAAGGGACAGTCATATCCCGCCAAAGGCGGCGCGCAACAACTGTTCTCCAACGAGAAAGGC
TCCTTCGGTCTGCTTCCCCGGGAGGGATCATGA