SecReT6
Effector Protein ID: 568306840
-
SecReT6 ID893
T6SS typeA3
Gene symbol-
Locus tagSCV20265_0101
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]120362..121522 [+]
ProductHypothetical protein
Effector typeProtein
Homologous effectorPA0099
DescriptionPA0099
UniProt IDV9TY47
KEGG IDpaes:SCV20265_0101
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 8.30E-38, Aligned region: 19..134
Tox-GHH2 [PF15635], Evalue: 2.20E-33, Aligned region: 226..344
Protein Sequence: 386 a.a.     [Download]
>gi|568306840|ref|YP_008979109.1| Hypothetical protein SCV20265_0101 [Pseudomonas aeruginosa SCV20265]
MANEVYANNMEISCKAASGKSIAAFPDVCFTPPQAPPTPLGVPIPYPNTGLSKDTTKGTRTIRITRKEVM
LKNKSYYKTSYGDEPGRAPKKGIVTSKIKGKVYFTSWSMNVKFESKNVVRHLDLTTHNHASFPGNTPVWP
YLDQATVDAGGGPCSNEVKKEKKDCADFKPHGSKDACAGLGAGKPSGKKTSNEADRLADKVAARKCLTAR
RCALQPYKPNSCCPQQTAHHLIEASALHDKGRGGKGSVPLKGISNYSENKAPCVCAEGVNQNVGTHGLMH
TFQSAAAAKSRSGTLQLSNGSSISAKKTTYGTAKRQSMAAMGKVFPQSKCSKECLSAQLDNYHKQCGINA
RTPIKAVETGQTDVTAATQAIKTRNARLGATRSRVR
-
Nucleotide Sequence: 1161 bp     [Download]
>gi|568306739|ref|NC_023149.1|:120362-121522 Pseudomonas aeruginosa SCV20265, complete genome
ATGGCCAACGAGGTGTACGCCAACAACATGGAGATCTCCTGCAAGGCGGCGAGCGGCAAGTCCATCGCGG
CCTTCCCGGATGTCTGCTTCACCCCGCCGCAGGCGCCGCCGACGCCGTTGGGGGTACCGATCCCCTACCC
CAATACCGGCCTGTCCAAGGACACCACCAAAGGCACCCGGACCATTCGCATCACCCGCAAGGAGGTGATG
CTGAAGAACAAGAGCTACTACAAGACCAGCTACGGCGACGAGCCGGGGCGGGCGCCGAAGAAGGGCATCG
TCACCAGCAAGATCAAGGGCAAGGTGTACTTCACCTCCTGGTCGATGAACGTCAAGTTCGAAAGCAAGAA
CGTGGTTCGCCACCTCGACCTGACCACCCACAACCACGCGTCCTTTCCTGGCAATACGCCGGTCTGGCCC
TACCTCGACCAGGCCACCGTCGATGCTGGTGGTGGACCGTGCAGCAATGAAGTGAAGAAGGAGAAGAAGG
ATTGCGCTGACTTCAAGCCGCATGGCAGCAAGGATGCCTGCGCTGGCCTTGGCGCGGGCAAGCCTTCCGG
CAAGAAGACCAGCAACGAAGCTGACCGACTGGCAGACAAGGTCGCTGCCCGAAAATGCCTGACCGCGCGC
CGGTGTGCCCTGCAACCGTACAAGCCGAACAGTTGCTGCCCGCAGCAGACCGCTCACCACCTGATCGAGG
CCAGCGCCTTGCACGACAAGGGACGTGGTGGAAAAGGCTCGGTACCCCTCAAGGGGATATCCAACTATTC
GGAGAACAAGGCTCCTTGCGTCTGCGCGGAGGGCGTCAATCAGAACGTGGGTACCCACGGCCTCATGCAC
ACGTTCCAGAGCGCCGCTGCCGCGAAGTCGCGCAGTGGAACCCTGCAATTGTCCAATGGCAGCTCCATCT
CCGCGAAGAAGACCACCTACGGAACGGCGAAACGTCAATCCATGGCTGCCATGGGCAAGGTCTTTCCGCA
GTCGAAATGCTCGAAGGAATGTCTGTCCGCTCAGCTCGACAACTATCACAAGCAGTGCGGAATCAACGCC
AGAACACCCATCAAGGCCGTTGAAACCGGCCAGACCGACGTCACGGCTGCGACGCAGGCGATAAAGACCC
GCAATGCGCGTCTTGGCGCCACGAGGAGTCGAGTCCGCTAG