SecReT6
Effector Protein ID: 568309302
-
SecReT6 ID893
T6SS typeA3
Gene symbol-
Locus tagSCV20265_2563
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]2658924..2660993 [+]
ProductVgrG protein
Effector typeProtein
Homologous effectorPA2685
Descriptiontype VI secretion system Vgr family protein
UniProt IDV9U2S5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.70E-86, Aligned region: 29..329
Phage_GPD [PF05954], Evalue: 6.70E-86, Aligned region: 347..394
Phage_base_V [PF04717], Evalue: 6.90E-26, Aligned region: 369..462
Gp5_C [PF06715], Evalue: 9.20E-09, Aligned region: 514..534
Gp5_C [PF06715], Evalue: 9.20E-09, Aligned region: 529..551
Gp5_C [PF06715], Evalue: 9.20E-09, Aligned region: 537..560
Gp5_C [PF06715], Evalue: 9.20E-09, Aligned region: 553..575
Gp5_C [PF06715], Evalue: 9.20E-09, Aligned region: 605..615
Gp5_C [PF06715], Evalue: 9.20E-09, Aligned region: 620..634
DUF2345 [PF10106], Evalue: 4.40E-05, Aligned region: 645..683
Protein Sequence: 689 a.a.     [Download]
>gi|568309302|ref|YP_008981571.1| VgrG protein [Pseudomonas aeruginosa SCV20265]
MLFSQHTRLVHVDSPLGPEVLQLQRLEGREELGRLFSHELELVSSNPALPLDALLGKPMSLALELPGGSR
RYFHGIVARCSQGAGAGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRS
YREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHEKKRHILVLSDAYGAHHSPAGYTSVPYYPPSLGHRER
DHFFDWHMAREVQPGSLSLNDYDFQRPGTRLEVRSNVGRAHAAADYPLYDYPGEYVQSQDGEHYARTRIE
AIQTQYERVRLRGCARGIGAGHLFHLSNYPRLDQNREYLVVGAEYRVVQELYETGNGGGGAQFESELDCI
DAGQAFRPLPSTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWMRVSQAWAGK
NWGSIQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGTKSRSSKGGTPANFNEIRM
EDKKGAEQLFIHAEKNQDIEVENDETHWVGHDRTKTIDHDETVHVKHDRTETVDNNETITVHANRSKTVD
RNETVRIGMNKTETILMASLQNVGMGRMENVGLGYSLNVGMMMNTVVGLNQSTQVMKKKTLSVGDSYEVS
VGGSDDGSKITLDGQSITLGSQRIELTADREILLRCGQSTIRLTPGEIEILSPNVDINC
-
Nucleotide Sequence: 2070 bp     [Download]
>gi|568306739|ref|NC_023149.1|:2658924-2660993 Pseudomonas aeruginosa SCV20265, complete genome
ATGCTGTTCTCCCAACACACCCGCCTGGTACACGTGGACTCCCCGCTGGGACCCGAGGTCCTGCAACTGC
AACGGCTGGAGGGTCGCGAAGAGCTGGGCCGGCTGTTCAGCCACGAGCTCGAACTGGTCTCGAGCAATCC
CGCCTTGCCTCTGGATGCCCTGTTGGGCAAGCCGATGAGCCTCGCGCTGGAACTCCCCGGCGGCAGCCGG
CGGTATTTCCACGGCATCGTCGCGCGCTGTAGCCAGGGCGCCGGCGCCGGCCAGTTCGCCAGCTACCAGG
TCACCCTGCGGCCCTGGCTGTGGCTGCTGACGCGCACCTCCGACTGCCGCATCTTCCAGAACCAGAAGGT
CCCGGACATCATCAAGCAGGTGTTCCGCGACCTTGGCTTCTCCGACTTCGAGGACGCCCTGAGCCGCTCC
TACCGCGAGTGGGAATACTGTGTGCAATACCGCGAGACCAGCTTCGATTTCGTCAGCCGGCTGATGGAGC
AGGAAGGCATTTACTACTGGTTCCGCCACGAAAAGAAGCGCCACATCCTGGTGCTCTCCGATGCCTACGG
CGCGCACCACAGCCCGGCCGGCTACACCAGCGTGCCCTATTACCCGCCGAGCCTCGGCCATCGCGAGCGC
GACCACTTCTTCGACTGGCACATGGCGCGCGAGGTCCAGCCCGGCTCGCTGAGCCTCAACGACTACGACT
TCCAGCGTCCCGGCACCCGCCTGGAAGTGCGCTCCAATGTCGGGCGCGCCCATGCCGCGGCCGACTACCC
GCTCTACGACTACCCTGGCGAGTATGTGCAGAGTCAGGACGGCGAACACTATGCACGGACCCGCATCGAG
GCGATCCAGACCCAGTACGAGCGAGTTCGCCTGCGGGGATGCGCCAGGGGTATCGGGGCGGGCCATCTGT
TCCACCTGAGCAACTACCCGCGCCTGGACCAGAACCGCGAATACCTGGTGGTTGGCGCCGAGTACCGGGT
AGTCCAGGAACTCTACGAGACCGGTAATGGCGGGGGCGGCGCGCAGTTCGAGAGCGAGCTGGACTGTATC
GACGCCGGCCAGGCTTTCCGCCCCTTGCCGTCGACCCCGGTGCCGGTGGTGCGCGGCCCGCAGACCGCGG
TGGTGGTCGGGCCCAAGGGCGAGGAGATCTGGACCGACCAGTACGGCCGGGTCAAGGTGCATTTCCATTG
GGACCGCCACGACCAGTCCAACGAGAACAGCTCCTGCTGGATGCGCGTCTCGCAGGCCTGGGCGGGGAAG
AACTGGGGCTCGATCCAGATCCCGCGGATCGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCGG
ACCGGCCGATCATCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGC
TACCCAGAGCGGCACCAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATG
GAGGACAAGAAGGGCGCCGAGCAGTTGTTCATCCATGCCGAGAAGAACCAGGACATCGAGGTCGAGAACG
ACGAGACCCACTGGGTCGGCCACGACCGGACCAAGACCATCGACCACGACGAGACCGTGCACGTGAAGCA
CGATCGCACCGAGACCGTGGACAACAACGAGACCATCACCGTGCATGCCAACCGCAGCAAGACGGTCGAC
CGCAACGAGACGGTCAGGATCGGCATGAACAAGACGGAAACCATCCTCATGGCCTCGTTGCAGAACGTCG
GCATGGGGCGCATGGAAAACGTCGGGCTCGGCTACAGCCTGAACGTCGGCATGATGATGAACACCGTGGT
CGGGCTGAACCAGAGCACCCAGGTGATGAAGAAGAAGACCTTGTCGGTGGGCGATAGCTACGAAGTGAGC
GTGGGCGGCAGCGACGATGGCTCGAAGATCACCCTGGACGGTCAGAGCATCACCCTCGGCAGCCAGCGCA
TCGAGCTGACCGCCGACCGCGAGATCCTCTTGCGCTGCGGCCAGAGCACGATCCGCCTGACGCCGGGGGA
GATCGAGATCCTCTCGCCCAATGTCGATATCAACTGTTGA