SecReT6
Effector Protein ID: 568310293
-
SecReT6 ID893
T6SS typeA3
Gene symbol-
Locus tagSCV20265_3556
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]3806197..3806661 [+]
ProductHypothetical protein
Effector typeProtein
Homologous effectorPA1844
DescriptionTse1
UniProt IDV9U6W2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 0.00025, Aligned region: 29..97
CHAP [PF05257], Evalue: 0.00025, Aligned region: 103..130
NLPC_P60 [PF00877], Evalue: 0.0012, Aligned region: 23..98
NLPC_P60 [PF00877], Evalue: 0.0012, Aligned region: 134..153
Protein Sequence: 154 a.a.     [Download]
>gi|568310293|ref|YP_008982562.1| Hypothetical protein SCV20265_3556 [Pseudomonas aeruginosa SCV20265]
MDSLDQCIVNACKNSWDKSYLAGTPNKDNCSGFVQSVAAELGVPMPRGNANAMVDGLEQSWTKLASGAEA
AQKAAQGFLVIAGLKGRTYGHVAVVISGPLYRQKYPMCWCGSIAGAVGQSQGLKSVGQVWNRTDRDRLNY
YVYSLASCSLPRAS
-
Nucleotide Sequence: 465 bp     [Download]
>gi|568306739|ref|NC_023149.1|:3806197-3806661 Pseudomonas aeruginosa SCV20265, complete genome
ATGGACAGTCTCGATCAATGCATCGTCAACGCCTGCAAGAACAGCTGGGACAAGAGCTACCTGGCCGGCA
CCCCGAACAAGGACAACTGTTCCGGCTTCGTCCAGTCGGTGGCCGCCGAGCTGGGCGTACCGATGCCCCG
CGGCAACGCCAACGCCATGGTCGACGGCCTGGAGCAGAGCTGGACCAAGCTCGCCTCCGGCGCCGAGGCC
GCGCAGAAGGCGGCCCAGGGCTTCCTGGTGATCGCCGGCCTGAAGGGCCGCACCTACGGGCACGTCGCGG
TGGTCATCAGCGGTCCGCTGTATCGGCAGAAGTACCCGATGTGCTGGTGCGGCAGCATCGCCGGCGCGGT
CGGCCAGAGCCAGGGCCTGAAGTCGGTCGGCCAGGTATGGAATCGCACCGACCGCGACCGCCTCAACTAC
TACGTCTACTCCCTGGCCAGTTGCAGCCTGCCCAGGGCCAGTTGA