SecReT6
Effector Protein ID: 59714137
-
SecReT6 ID84
T6SS typeA1
Gene symbol-
Locus tagVF_A0954
StrainVibrio fischeri ES114
Repliconchromosome I [GenBank: NC_006841] [Browse all T6SS(s) in this replicon]
Location [Strand]1073259..1073777 [-]
Producthemolysin co-regulated protein
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDQ5DYX2
KEGG IDvfi:VF_A0954
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.00E-39, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|59714137|ref|YP_206912.1| hemolysin co-regulated protein [Vibrio fischeri ES114]
MPTPAYMRIEGEKQGLITAGTFTEDSVGNIYQEGHEDEVLVQGFEHQVLLPRDPQSGQPTGQRVHKPVRI
TKVFDKASPLMYNALTSGEKLPKVEIKWYRTSATGTQEHYFTTVLHDAIIVDITASMPNCQDPSQAHFTH
LEDVFMTYRAIDWTHEVAGTSGNDDWRTAMKA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|172087787|ref|NC_006841.2|:c1073777-1073259 Vibrio fischeri ES114 chromosome II, complete sequence
ATGCCAACTCCAGCTTATATGCGCATTGAAGGCGAAAAACAGGGACTAATTACTGCAGGTACATTTACTG
AAGATTCAGTAGGTAACATTTACCAAGAAGGTCATGAAGACGAAGTATTAGTTCAAGGATTTGAACATCA
GGTTTTATTACCTCGTGATCCTCAATCAGGTCAGCCTACTGGTCAACGTGTGCATAAGCCTGTACGTATT
ACAAAAGTATTCGATAAGGCATCACCACTAATGTATAACGCATTAACGTCTGGTGAGAAACTGCCTAAAG
TTGAGATTAAGTGGTACCGTACTTCTGCAACAGGTACACAAGAGCACTATTTCACAACAGTTCTACACGA
TGCGATTATCGTTGATATCACAGCGTCAATGCCTAACTGTCAAGACCCATCACAAGCGCATTTCACACAC
CTAGAAGATGTATTTATGACATATCGTGCCATTGATTGGACGCACGAAGTCGCAGGTACATCAGGTAACG
ATGACTGGCGTACAGCAATGAAAGCGTAA