SecReT6
Effector Protein ID: 611963723
xmtU
SecReT6 ID931
T6SS type
Gene symbolxmtU
Locus tagxmtU
StrainEscherichia coli 17-2
RepliconT6SS [GenBank: KF678350] [Browse all T6SS(s) in this replicon]
Location [Strand]24197..25636 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorXmtU
DescriptionXmtU contains Peptidase_C39 toxin domain and a PAAR motif.
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 1.60E-23, Aligned region: 14..116
Peptidase_C39 [PF03412], Evalue: 4.90E-07, Aligned region: 352..474
PAAR_motif [PF05488], Evalue: 6.50E-05, Aligned region: 78..106
Peptidase_C39_2 [PF13529], Evalue: 0.00025, Aligned region: 354..391
Peptidase_C39_2 [PF13529], Evalue: 0.00025, Aligned region: 431..455
Protein Sequence: 479 a.a.     [Download]
>gi|611963723|ref|AHW84522.1| hypothetical protein [Escherichia coli]
MGNYHIGDGECRFRVVCSSPDVCEVGGYKVPFDSYQTLDSERQYSSTVWARGCRALNVGSVIAGTQSNAG
KGVISGTSQGTGDCVILTGSPTVTIEGKPVAYHGSVVGINNHNCLGKLYTKIKSPMISVIDRTFNYERTA
EVIHDLLLLKDLLSVGNIFDGDISPEVKNDLFQIKDPDQSWGEFFSIKNIRESLRNGIEGDKSQIREWFG
ENTLTQMGNGAITTLHGVADLALVTFDALLDTATATVACPIGEDGLCEQANINLNEKEQALFNISNSLIN
GQAWDALKKMIMDTNNGDQIALEHFASFLWGFMIPAKIPEENISGKVFVEPVVLEGGAGGNWTVFDEVLD
SNVIKQLTLTGCGAACGEMLLRDRYIFVTQNVIGTELTSMTSLANKLNKFDVGWEGNAVSESSLYALSNT
GSWGAMMWDSGSKVGHWVLVKGVDDAGNVIIYDPYQGSRYLMTEQEFKEVWNGHSVYKP
-
Nucleotide Sequence: 1440 bp     [Download]
>gi|611963702|gb|KF678350|xmtU|:24197-25636
ATGGGTAACTATCATATCGGGGATGGTGAATGTAGATTTAGAGTCGTGTGTTCTTCACCAGATGTATGTG
AAGTAGGAGGTTACAAGGTTCCTTTTGACAGTTACCAGACTTTAGATAGTGAAAGACAGTACAGTTCAAC
GGTATGGGCGCGTGGATGCAGAGCTTTAAATGTTGGTTCAGTGATTGCTGGAACTCAAAGTAATGCCGGT
AAAGGTGTCATATCCGGTACATCTCAAGGAACGGGTGACTGTGTTATTTTAACGGGAAGTCCGACTGTAA
CAATAGAAGGGAAACCTGTTGCTTATCATGGTTCAGTTGTTGGGATTAATAACCACAACTGCCTTGGTAA
ATTGTATACCAAAATAAAATCACCAATGATTTCTGTCATTGATAGAACTTTTAATTATGAAAGGACTGCT
GAAGTAATACACGATTTACTGCTTCTGAAGGATCTCCTCTCTGTTGGTAATATTTTTGACGGAGATATTT
CACCTGAGGTTAAAAATGATTTATTTCAAATAAAAGATCCTGACCAATCATGGGGGGAGTTTTTTTCAAT
AAAGAATATCAGAGAATCTCTCAGGAATGGTATTGAAGGAGATAAATCTCAGATCAGAGAATGGTTTGGA
GAGAACACACTTACTCAAATGGGGAATGGAGCAATCACCACTTTACATGGTGTGGCGGATTTAGCCTTAG
TTACATTCGATGCTCTGTTAGATACGGCAACGGCAACGGTTGCTTGCCCGATAGGCGAAGATGGGTTATG
TGAACAGGCAAATATAAATTTAAATGAAAAAGAACAGGCTTTATTTAATATTAGTAATTCATTGATAAAT
GGGCAAGCATGGGATGCACTTAAAAAAATGATAATGGATACAAATAATGGTGATCAGATTGCTCTGGAGC
ATTTTGCCAGCTTTTTATGGGGCTTTATGATACCCGCAAAAATACCAGAAGAAAATATCTCTGGGAAAGT
ATTTGTAGAGCCAGTAGTTTTAGAAGGTGGTGCTGGTGGCAATTGGACAGTATTTGATGAGGTTTTAGAT
TCAAATGTAATAAAGCAATTGACTTTAACAGGCTGTGGAGCGGCCTGTGGGGAAATGTTGCTTAGGGATA
GGTATATTTTTGTCACGCAAAATGTAATTGGAACAGAATTAACATCTATGACGTCGCTGGCAAACAAGCT
TAATAAATTTGATGTCGGCTGGGAAGGGAATGCAGTGAGCGAATCTAGTTTATATGCCCTCAGTAATACT
GGTTCATGGGGAGCAATGATGTGGGATTCTGGAAGTAAAGTAGGGCATTGGGTACTTGTTAAGGGTGTTG
ATGATGCTGGGAATGTGATAATATATGATCCATATCAAGGGAGTCGATATCTGATGACTGAACAGGAATT
TAAGGAGGTATGGAATGGGCATAGTGTTTACAAACCATAA