SecReT6
Effector Protein ID: 659039135
-
SecReT6 ID949
T6SS type
Gene symbol-
Locus tagB5C30_RS14465
StrainVibrio parahaemolyticus strain 12-297/B C4271
RepliconT6SS [GenBank: NZ_MYFG01000470] [Browse all T6SS(s) in this replicon]
Location [Strand]18950..20299 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorV12_14465 (PoNe)
DescriptionV12_14465 is a bona fide antibacterial DNase toxin,and purified V12_14465 or its PoNe domain (V12_14465283–449) exhibited magnesium-dependent DNase activity in vitro.
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 449 a.a.     [Download]
>gi|659039135|ref|WP_029857615.1| hypothetical protein [Vibrio parahaemolyticus]
MLGNDIFEALYDNLEQAVGNAEGFIKEKAQQLSDAASASFEWIWEALQGDFNEDMSTGQIAANALLGLIP
IVDQILDCRDLAANCRKIHEEPEDSWAWVALVLTLIGLIPTLGSAVKGVLKIIFLFVRKSGGDMGKALGR
SLKPINTFLLDPKVQKVLGNISVPSVLKDVVEKLNSIKSLLSTSTLLNLFDEVINTFKGLIAKLKSLAPD
EVITWMESALRSMQYVRTQADKMLPNALKEAIYKLEDLELALKKQIKSLEQPHKALADTKSIHRLDDSVA
QIDPHIIRSMKNSQKGIYGEIISDHHMKERGFINLLPEDRQVRKMTDKPRGRGIDGIYQNTNPPPPYVVT
ETKYRTEVGKYIDDDGIAKDTMLSTTKGSKVNGMSYPPTKQMSDGWIEPRLIDELGLEGAEDILDMDFER
WLMIVDDSGKVINITKLDEHAKALEKVAM
-
Nucleotide Sequence: 1350 bp     [Download]
>gi|1189148301|ref|NZ_MYFG01000470.1|:c20299-18950 Vibrio parahaemolyticus strain 12-297/B C4271, whole genome shotgun sequence
ATGTTAGGTAATGATATTTTTGAAGCGCTCTATGACAACTTAGAACAAGCAGTAGGCAATGCCGAAGGGT
TCATTAAAGAAAAAGCCCAACAACTTTCTGATGCAGCATCGGCAAGTTTTGAATGGATTTGGGAAGCCTT
GCAAGGCGACTTCAATGAAGACATGTCTACTGGTCAAATTGCCGCGAATGCTTTATTAGGGCTCATCCCA
ATCGTTGATCAAATCCTAGACTGTCGAGATTTAGCCGCTAACTGTCGAAAAATACATGAAGAGCCTGAAG
ATAGCTGGGCTTGGGTGGCTCTGGTTCTTACCTTGATAGGTTTAATCCCCACGTTAGGTTCCGCTGTTAA
AGGGGTTCTAAAGATAATATTTCTTTTTGTTCGGAAGTCTGGCGGAGATATGGGAAAAGCGCTGGGTCGT
TCATTAAAACCGATCAATACATTTTTGCTGGACCCAAAAGTACAAAAGGTTCTAGGAAATATCAGCGTAC
CATCAGTCCTTAAAGATGTGGTTGAAAAACTTAATAGCATCAAAAGTCTGCTATCTACCAGTACACTACT
TAACCTGTTTGATGAAGTGATTAATACGTTTAAAGGACTAATAGCAAAACTGAAATCACTTGCACCGGAT
GAAGTAATAACGTGGATGGAAAGTGCCCTCAGAAGCATGCAATATGTGCGAACACAAGCAGATAAGATGC
TTCCCAATGCGTTAAAAGAAGCGATTTATAAATTAGAAGATCTTGAGCTTGCGTTAAAAAAACAAATCAA
GAGCCTGGAGCAACCTCACAAGGCGTTAGCCGACACTAAATCTATCCATAGACTTGATGATAGTGTTGCT
CAAATTGATCCCCATATCATTCGTTCGATGAAAAACTCCCAAAAAGGGATATATGGCGAGATTATCAGCG
ATCACCATATGAAAGAGCGAGGCTTTATTAACTTGTTACCTGAAGACCGGCAAGTCAGGAAGATGACAGA
TAAGCCCCGTGGGCGAGGTATTGATGGTATCTACCAAAATACTAATCCGCCGCCGCCCTATGTTGTTACT
GAAACTAAGTACCGAACTGAAGTTGGAAAATACATTGATGACGATGGTATTGCGAAAGATACCATGCTTA
GTACGACTAAAGGTAGTAAGGTCAATGGTATGAGCTACCCTCCCACAAAGCAAATGAGTGATGGGTGGAT
TGAACCACGTTTAATTGATGAGCTAGGACTTGAAGGGGCAGAAGATATATTAGACATGGATTTTGAGCGT
TGGTTGATGATAGTTGATGATTCAGGAAAAGTGATTAACATTACAAAATTAGATGAGCATGCAAAAGCTC
TCGAAAAGGTGGCTATGTGA

Reference
(1) Biswanath Jana, Chaya M Fridman, Eran Bosis, Dor Salomon (2019). A Modular Effector With a DNase Domain and a Marker for T6SS Substrates. Nat Commun. 10(1):3595. [PudMed:31399579] experimental
 
experimental experimental literature