SecReT6
Effector Protein ID: 66048189
-
SecReT6 ID86
T6SS typeA4b
Gene symbol-
Locus tagPsyr_4965
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T6SS(s) in this replicon]
Location [Strand]5889737..5890255 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPsyr_4965
DescriptionHcp protein
UniProt IDQ4ZLI0
KEGG IDpsb:Psyr_4965
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.50E-41, Aligned region: 6..146
Protein Sequence: 172 a.a.     [Download]
>gi|66048189|ref|YP_238030.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MAFDAYIQIDGIPGEVLDDKHKDWIEVLGYEFGATQATSATASSSGGASSERVALSDFSIRKSVDKASAK
LFEACCKGTHIAKIQLNVNRAGGDKLTYLTINLEEVVVSSVKAVAGGSQKGEDNAVSDLPIEEISFNFAR
IKTTYTQQSRSDGQGGGNVTGGWDRTANKVFA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|66043271|ref|NC_007005.1|:5889737-5890255 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGGCATTTGACGCATACATCCAAATCGATGGCATCCCAGGCGAAGTTCTGGACGACAAGCACAAGGACT
GGATCGAAGTGTTGGGCTACGAGTTCGGCGCTACCCAGGCCACCTCGGCGACCGCCAGTTCTTCGGGCGG
TGCTTCGTCCGAGCGCGTTGCACTGAGCGACTTCAGCATCCGCAAGTCTGTGGACAAGGCTTCCGCCAAG
CTGTTCGAAGCGTGCTGCAAGGGCACTCACATCGCCAAGATCCAGCTGAACGTCAACCGTGCAGGCGGCG
ACAAGCTGACCTACCTGACCATCAACCTGGAAGAAGTGGTTGTGTCTTCCGTGAAGGCGGTTGCTGGCGG
TAGCCAGAAAGGCGAAGACAACGCAGTCAGCGATCTGCCGATTGAAGAAATCAGCTTCAACTTCGCTCGC
ATCAAGACCACCTACACCCAGCAGAGCCGTTCCGATGGCCAGGGTGGCGGTAACGTCACTGGCGGCTGGG
ACCGCACTGCGAACAAAGTATTCGCATAA

Reference
(1) Records AR et al. (2010). Sensor kinases RetS and LadS regulate Pseudomonas syringae type VI secretion and virulence factors. J Bacteriol. 192(14):3584-96. [PudMed:20472799] experimental
 
experimental experimental literature