SecReT6
Effector Protein ID: 70730402
-
SecReT6 ID35
T6SS typeA3
Gene symbol-
Locus tagPFL_3037
StrainPseudomonas protegens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T6SS(s) in this replicon]
Location [Strand]3502760..3503293 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPFL_3037 (Tge2)
DescriptionTge2; Muramidase
UniProt IDQ4KC90
KEGG IDpfl:PFL_3037
PDB ID4KT3
Domain hit(s) vs Pfam Glucosaminidase [PF01832], Evalue: 3.10E-14, Aligned region: 46..167
Protein Sequence: 177 a.a.     [Download]
>gi|70730402|ref|YP_260143.1| unnamed protein product [Pseudomonas fluorescens Pf-5]
MGPGLLYNHAAKTAVNGIDRSTEGTNVSARLCNNISAVTFVSKYKAVCQPIADQLDLPVENLLGLAAQES
QYGTGRIARELNNYFSMHAPAPLQIGAEAPLGNASIKVAKFDSFQKSAQSFASSFGTAVRGQRDPMAFAQ
ALVRSGYNTGNAKTGGRDGFARYLADIIIAVRGRMAC
-
Nucleotide Sequence: 534 bp     [Download]
>gi|70728250|ref|NC_004129.6|:c3503293-3502760 Pseudomonas fluorescens Pf-5 chromosome, complete genome
GTGGGCCCCGGGTTGCTTTATAATCACGCGGCGAAAACCGCAGTAAATGGAATTGACCGGTCAACCGAGG
GAACAAACGTGAGCGCCAGACTCTGCAACAACATCAGTGCCGTGACCTTTGTCAGCAAGTACAAGGCGGT
GTGCCAGCCGATTGCCGACCAGCTGGACCTGCCGGTGGAAAACCTGCTGGGCCTGGCCGCCCAGGAAAGC
CAGTACGGCACCGGGCGCATTGCCCGGGAACTGAACAACTACTTTTCCATGCACGCACCGGCCCCCCTGC
AGATCGGCGCCGAGGCGCCCCTGGGCAACGCCAGCATCAAGGTGGCCAAGTTCGACTCCTTCCAGAAGTC
CGCCCAGTCCTTTGCTTCGAGCTTTGGCACGGCAGTACGTGGCCAGCGTGACCCCATGGCATTCGCCCAG
GCGCTGGTACGCAGCGGCTACAACACCGGCAACGCCAAGACCGGCGGCCGGGATGGCTTCGCCCGCTACC
TGGCGGACATCATCATCGCGGTCAGAGGGCGCATGGCGTGCTGA

Reference
(1) Whitney JC et al. (2013). Identification, structure and function of a novel type VI secretion peptidoglycan glycoside hydrolase effector-immunity pair. J Biol Chem. 288(37):26616-24. [PudMed:23878199] experimental
 
experimental experimental literature