SecReT6
Effector Protein ID: 70732799
-
SecReT6 ID35
T6SS typeA3
Gene symbol-
Locus tagPFL_5498
StrainPseudomonas protegens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T6SS(s) in this replicon]
Location [Strand]6278373..6278744 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPFL_5498 (Tae3)
DescriptionTae3; peptidoglycan amidase
UniProt IDQ4K5B7
KEGG IDpfl:PFL_5498
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 0.00016, Aligned region: 15..89
Protein Sequence: 123 a.a.     [Download]
>gi|70732799|ref|YP_262566.1| unnamed protein product [Pseudomonas fluorescens Pf-5]
MWNKEAAISHLNAHAHAGSTGRCAAYTRQAIEAGGGGVILHRKHSAKDFGSSLTSAGFIEQPAGQTPAAG
DVVIIQPIPGHPHGHMAMFNGTLWVSDFKQLHGFYPGHSYRVQKPAYKIYRHP
-
Nucleotide Sequence: 372 bp     [Download]
>gi|70728250|ref|NC_004129.6|:6278373-6278744 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGTGGAATAAAGAAGCCGCTATCAGTCACTTGAACGCTCACGCTCACGCCGGTAGTACGGGGCGCTGTG
CGGCCTATACTCGCCAGGCGATCGAAGCCGGTGGCGGTGGGGTGATTCTGCACAGGAAGCACTCGGCCAA
GGACTTCGGCTCATCATTGACTTCTGCAGGTTTCATCGAACAGCCGGCCGGCCAGACGCCCGCAGCGGGC
GATGTGGTGATCATCCAGCCCATTCCAGGGCACCCCCACGGTCACATGGCGATGTTCAACGGCACACTCT
GGGTGTCAGACTTCAAGCAACTGCACGGTTTCTACCCGGGGCATTCCTACCGGGTGCAGAAACCTGCCTA
CAAAATCTATCGCCATCCGTAA

Reference
(1) Russell AB et al. (2012). A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 11(5):538-49. [PudMed:22607806] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature