SecReT6
Effector Protein ID: 70733372
hcp
SecReT6 ID35
T6SS typeA3
Gene symbolhcp
Locus tagPFL_6089
StrainPseudomonas protegens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T6SS(s) in this replicon]
Location [Strand]6916187..6916675 [+]
Producttype VI secretion system effector Hcp
Effector typeProtein
Homologous effectorPA0085
DescriptionHcp protein
UniProt IDQ4K3N6
KEGG IDpfl:PFL_6089
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.80E-46, Aligned region: 6..137
Protein Sequence: 162 a.a.     [Download]
>gi|70733372|ref|YP_263147.1| hcp gene product [Pseudomonas fluorescens Pf-5]
MAVDIFIKIGDIKGESMDKAHKDEIDVLNWSWGMSQSGNMHVGGGGGAGKVNIQDLSLTKYVDKASPNLM
MHCSSGKHIDKVRLTVRKAGGESQVEYMIIDLEEVLITSLSTGGSGSDDRLTENITLNFAQVMVEYQPQK
ADGTKDGGPIKYGWNIRSNTKR
-
Nucleotide Sequence: 489 bp     [Download]
>gi|70728250|ref|NC_004129.6|:6916187-6916675 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGGCTGTTGATATTTTCATCAAGATCGGTGACATCAAGGGCGAGTCCATGGACAAAGCCCACAAGGACG
AAATCGACGTGTTGAACTGGAGCTGGGGCATGTCCCAGTCCGGCAACATGCACGTTGGCGGTGGCGGCGG
CGCGGGCAAGGTGAACATCCAGGACCTGTCGCTGACCAAGTACGTGGACAAGGCATCGCCGAACCTGATG
ATGCATTGCTCCAGCGGCAAGCACATCGACAAGGTGCGCCTGACCGTGCGCAAGGCCGGCGGCGAAAGCC
AGGTCGAGTACATGATCATCGACCTGGAAGAAGTGCTGATCACTTCCCTGAGCACCGGCGGTTCGGGCAG
CGATGACCGCCTGACCGAAAACATCACCCTGAACTTCGCTCAGGTGATGGTCGAGTACCAGCCGCAGAAA
GCCGACGGCACCAAGGACGGCGGCCCGATCAAGTACGGCTGGAACATCCGCTCCAACACCAAGCGCTGA