SecReT6
Effector Protein ID: 70733379
-
SecReT6 ID35
T6SS typeA3
Gene symbol-
Locus tagPFL_6096
StrainPseudomonas protegens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T6SS(s) in this replicon]
Location [Strand]6925413..6929873 [+]
ProductRhs family protein
Effector typeProtein
Homologous effectorPFL_6096
DescriptionrhsA contains an N-terminal PAAR domain, and a polymorphic C-terminal toxin domain,which belongs to a superfamily of restriction endonucleases possessing a conserved aspartic acid dyad (NCBI conserved domain accession number cl00516).
UniProt IDQ4K3M9, Q4K3M9
KEGG IDpfl:PFL_6096
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 439..455
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 499..534
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 554..577
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 588..623
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 614..644
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 660..685
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 673..709
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 715..750
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 736..772
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 780..810
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 799..835
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 841..871
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 900..935
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 944..978
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 1021..1033
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 1045..1065
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 1056..1092
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 1080..1109
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 1131..1142
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 1134..1167
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 1155..1186
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 1191..1239
RHS [PF03527], Evalue: 5.60E-21, Aligned region: 657..683
RHS [PF03527], Evalue: 5.60E-21, Aligned region: 819..831
RHS [PF03527], Evalue: 5.60E-21, Aligned region: 963..972
RHS [PF03527], Evalue: 5.60E-21, Aligned region: 1015..1032
RHS [PF03527], Evalue: 5.60E-21, Aligned region: 1133..1143
RHS [PF03527], Evalue: 5.60E-21, Aligned region: 1188..1201
RHS [PF03527], Evalue: 5.60E-21, Aligned region: 1244..1282
PAAR_motif [PF05488], Evalue: 1.10E-09, Aligned region: 97..226
PAAR_motif [PF05488], Evalue: 1.10E-09, Aligned region: 227..290
DUF4595 [PF15283], Evalue: 0.00033, Aligned region: 479..514
DUF4595 [PF15283], Evalue: 0.00033, Aligned region: 601..630
DUF4595 [PF15283], Evalue: 0.00033, Aligned region: 788..857
DUF4595 [PF15283], Evalue: 0.00033, Aligned region: 929..958
DUF4595 [PF15283], Evalue: 0.00033, Aligned region: 1151..1181
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 439..455
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 499..534
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 554..577
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 588..623
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 614..644
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 660..685
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 673..709
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 715..750
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 736..772
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 780..810
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 799..835
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 841..871
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 900..935
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 944..978
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 1021..1033
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 1045..1065
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 1056..1092
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 1080..1109
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 1131..1142
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 1134..1167
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 1155..1186
RHS_repeat [PF05593], Evalue: 1.60E-66, Aligned region: 1191..1239
RHS [PF03527], Evalue: 5.60E-21, Aligned region: 657..683
RHS [PF03527], Evalue: 5.60E-21, Aligned region: 819..831
RHS [PF03527], Evalue: 5.60E-21, Aligned region: 963..972
RHS [PF03527], Evalue: 5.60E-21, Aligned region: 1015..1032
RHS [PF03527], Evalue: 5.60E-21, Aligned region: 1133..1143
RHS [PF03527], Evalue: 5.60E-21, Aligned region: 1188..1201
RHS [PF03527], Evalue: 5.60E-21, Aligned region: 1244..1282
PAAR_motif [PF05488], Evalue: 1.10E-09, Aligned region: 97..226
PAAR_motif [PF05488], Evalue: 1.10E-09, Aligned region: 227..290
DUF4595 [PF15283], Evalue: 0.00033, Aligned region: 479..514
DUF4595 [PF15283], Evalue: 0.00033, Aligned region: 601..630
DUF4595 [PF15283], Evalue: 0.00033, Aligned region: 788..857
DUF4595 [PF15283], Evalue: 0.00033, Aligned region: 929..958
DUF4595 [PF15283], Evalue: 0.00033, Aligned region: 1151..1181
Protein Sequence: 1486 a.a.     [Download]
>gi|70733379|ref|YP_263154.1| unnamed protein product [Pseudomonas fluorescens Pf-5]
MSDALWAARLGDGLEHTSMMADILGGVLEVAANVAIGALATMAVAAAAGITVATGGLGACVLGLVVGVVV
GVVMSKTGADKGLSNLCEGIANALFPPSIQATIASGSKKVLTNNKPAARAAGIAPPTQISGDGAEEGEAT
DTPSATPEEGPGFLDMAKEFFSQMWRPTVASPAPGSQTKELDLVTCTKHPPMPVQYLAEGSEKVSIDGQP
AVRSGDRSTCDAKVVSAGPISPNVTIGGGSVVVREIRSGKTPGVGLAVTVLMMLKGGKGKFLSNLPCMLM
AGVNSFVVSQATNALTQAVVASTHPVHAATGAKVLGADDDLDFTLPGLMPIEWQRFYNSRDERRDGLLGA
GWSLPYEISVQIEPHPEGGERLLYIDEQGRRIDMGSIALGAGAFSPGEGLSVRRNENGQLLIESSDGIYR
LFEPLPGDSSRLRLSLLGDRNDNRLHLEYDSSGRLWLLRDTFEQAQLELSYSTLWPGRIAQVERLYPDQQ
REVLVSYDYDAAGDLAQVRDSEGQVQRRFAYDAGHRMIEHQLATGLRCFYQWTQFADQQWRVTRHWTDEG
DSYQYDYDLEAGITQVTDSLQRLSRRRWNSQLQIVEYTDNLNQTWAFEWNDERQLLSATDPLGGRYAYSY
DETGNLIAETDPLGHSHSTLWLEHWSLPQTLTDPAGESWHLRYDPRGNCIAEVDPLGQVTQYRHDAHGQV
VEIIDAAGRSRKMRWNSSGQLLEHLDCSGYPTRFEYDRRGNVKAIIDALGEHTRFHYDCQGRLLSSQLAD
GRAEHFQRSSNGQLQGYTDPSGYTTLYQYNRRGQIRQRIDAHGRQVRFDYDAYGRLLALTNENGESYRFA
WDAGNRLSEQQDLDGSAKRYGYDLLNNVVELQSHPAPYGTGLSAVPAQPIAPIIHRFERDAVGRLLAKIT
DDGRSQYTYDPLNQLTAASFTDNLGNQQALSFSYDALGQLLEEHTVAGSLIHRYDELGNLTQTQLPDKRW
LNRLYYGSGHLHQINLDGQVVSDFQRDRLHREVLRTQGQISTRSEYDRCGRLRARLQHSSLLANTLPTAP
ERHLEYDDSDNLVGLAERHATGQHRQLFHYDATGRIIASQDGLQGQKETFAYDAAANLLDGPKAGAGLVV
HNKLLTYQDKRYRYDAFGRMIEKRSGRRGVQRFAYDAEHRLIEVRNQTSSGETLVRMRYDVLGRRISKSE
YDSQGNLLGETRFVWDGLRLLQEQRNQQTSLYVYEDLGHAPLARVDGLGAQQKIRYYHNDLNGLPQQLCE
PDGHSVWQARYQVWGNTVEEIREPYYIEEQNLRFQGQYLDRETGLHFNTFRFYDPDIGRFTTPDPIGLAG
GLNLYQYAPNPIGWIDPLGWICKSAYSGRRGTTKAKADLERNGFTVVGEELTMKVKHPVTQKSYRIRADI
IAKDKAGNYHVFEVKNGSGKLTKNQQGSGMFDMSNPANTNGGLGGGLIKPSGATQGQFEVATKTARGTQF
GGNGAQHSATFWLLRY
-
Nucleotide Sequence: 4461 bp     [Download]
>gi|70728250|ref|NC_004129.6|:6925413-6929873 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGTCTGACGCACTGTGGGCCGCCCGCCTGGGTGACGGGCTGGAACACACCTCGATGATGGCCGACATTC
TCGGCGGTGTGCTGGAGGTGGCGGCCAACGTTGCCATCGGCGCCCTGGCGACCATGGCAGTAGCCGCGGC
GGCAGGCATCACCGTGGCCACCGGCGGCCTCGGCGCCTGTGTGCTGGGGCTGGTGGTGGGCGTCGTCGTC
GGCGTGGTCATGAGCAAGACCGGAGCCGACAAGGGCCTGAGCAATTTATGCGAGGGTATCGCCAACGCCC
TGTTCCCGCCCTCGATCCAGGCCACCATCGCCAGCGGCTCGAAAAAGGTCCTGACCAACAACAAGCCGGC
GGCCCGCGCGGCCGGCATCGCACCGCCGACACAGATCAGCGGCGACGGCGCCGAAGAAGGCGAAGCCACC
GACACCCCGTCGGCAACGCCCGAGGAAGGGCCCGGTTTCCTCGACATGGCCAAGGAGTTTTTCTCGCAGA
TGTGGCGGCCCACCGTGGCCTCCCCGGCGCCAGGCTCCCAGACCAAGGAACTGGACCTGGTGACCTGCAC
CAAGCACCCGCCGATGCCGGTGCAGTATCTGGCTGAAGGCTCGGAAAAGGTCAGCATCGACGGCCAGCCG
GCAGTACGCAGCGGCGACCGCAGCACCTGCGATGCCAAGGTAGTGTCGGCCGGGCCTATCTCCCCGAACG
TGACCATCGGCGGTGGCTCGGTGGTGGTGCGCGAGATCCGTAGCGGCAAGACCCCGGGGGTGGGCCTGGC
GGTGACCGTGCTGATGATGCTCAAGGGCGGCAAGGGCAAGTTCCTCAGCAACCTGCCGTGCATGCTGATG
GCCGGGGTCAATTCCTTTGTCGTCAGCCAGGCCACCAATGCTTTGACCCAGGCCGTCGTCGCCTCGACCC
ACCCGGTGCATGCAGCCACCGGGGCCAAGGTGCTCGGAGCCGACGACGATCTGGATTTCACCCTGCCCGG
GCTGATGCCCATCGAATGGCAACGCTTCTACAACAGCCGCGACGAACGTCGTGACGGCCTGCTCGGGGCC
GGCTGGAGCTTGCCTTACGAGATCAGCGTCCAGATCGAGCCCCACCCCGAAGGTGGCGAGCGTCTGCTCT
ACATTGATGAGCAAGGACGCCGCATCGACATGGGCTCCATTGCCCTGGGTGCAGGAGCCTTCAGCCCCGG
TGAAGGCTTGAGCGTGCGACGCAACGAGAACGGACAGTTGCTGATCGAAAGCAGCGACGGTATCTACCGT
CTGTTCGAGCCGCTGCCGGGCGACTCCTCGCGGCTGCGCCTGAGCCTGCTGGGGGACCGCAACGACAACC
GTCTGCACCTGGAGTACGACTCGTCCGGACGCCTCTGGCTGCTGCGTGACACCTTTGAACAGGCGCAGCT
CGAACTGAGCTACAGCACGCTCTGGCCCGGTCGGATTGCCCAGGTCGAACGGCTGTACCCCGACCAGCAA
CGGGAAGTGCTGGTCAGCTATGACTACGATGCGGCAGGAGACCTGGCACAGGTGCGCGATAGCGAAGGCC
AGGTACAGCGTCGCTTCGCTTATGACGCCGGCCACCGGATGATCGAACATCAATTGGCCACCGGGCTGCG
CTGCTTCTATCAATGGACACAATTTGCCGACCAGCAGTGGCGAGTGACCCGTCACTGGACCGACGAAGGC
GATAGCTATCAGTACGACTATGATCTGGAGGCGGGAATCACCCAGGTCACCGACAGCCTGCAACGCCTCA
GCCGCCGCCGCTGGAACAGCCAGTTGCAGATCGTCGAGTACACCGACAACCTCAACCAGACATGGGCCTT
CGAGTGGAACGATGAGCGCCAACTGCTCAGCGCCACCGACCCCTTGGGAGGGCGCTATGCCTATAGCTAC
GACGAAACCGGCAACCTGATAGCCGAGACCGATCCTCTGGGGCACAGCCATTCGACCTTGTGGCTGGAGC
ACTGGTCGCTGCCACAGACCCTGACCGATCCCGCCGGAGAAAGCTGGCACCTGCGCTACGATCCCCGGGG
CAACTGTATCGCCGAAGTAGACCCGCTGGGCCAGGTGACCCAGTACCGCCATGACGCGCACGGCCAGGTG
GTGGAGATCATCGATGCCGCGGGAAGAAGCCGGAAGATGCGCTGGAACTCGTCCGGGCAATTGCTTGAAC
ACCTGGACTGCTCGGGCTATCCAACCCGCTTCGAATACGATCGACGCGGCAACGTGAAAGCCATCATCGA
TGCCCTTGGCGAGCACACCCGGTTCCATTACGACTGCCAGGGACGGTTGCTGAGCAGCCAACTGGCCGAT
GGGCGCGCCGAGCATTTTCAACGCAGCAGCAACGGCCAGCTACAGGGCTACACCGACCCTTCCGGCTACA
CCACGCTCTACCAGTACAACCGGCGCGGGCAGATACGCCAGCGCATCGACGCTCACGGCCGACAGGTCCG
GTTCGACTATGACGCGTACGGACGGCTGCTGGCGCTCACCAACGAGAACGGCGAAAGCTATCGCTTTGCC
TGGGACGCCGGCAACCGCCTGAGCGAACAGCAGGACCTCGACGGCAGTGCCAAACGCTATGGCTATGACC
TGCTGAACAACGTCGTCGAACTCCAGTCCCACCCCGCCCCTTATGGCACCGGGCTGAGCGCCGTGCCCGC
GCAACCTATCGCGCCGATCATCCACCGGTTCGAGCGCGATGCCGTGGGGCGGCTGCTGGCCAAAATCACA
GACGATGGCCGCAGCCAATACACCTACGACCCCTTGAACCAACTGACCGCCGCCAGCTTTACCGACAACC
TCGGCAACCAGCAGGCACTGAGTTTCAGCTACGACGCCCTGGGCCAATTACTCGAAGAACACACCGTGGC
CGGCAGCCTGATCCATCGATACGACGAACTGGGCAATTTGACTCAGACCCAGCTACCGGACAAGCGTTGG
CTCAACCGGCTCTATTACGGCAGCGGCCATCTGCACCAGATCAATCTCGATGGCCAGGTAGTCAGCGACT
TTCAACGTGACCGCCTGCACCGTGAGGTGCTGCGCACCCAGGGTCAGATCAGCACTCGCAGCGAATACGA
CCGGTGTGGCCGCCTGCGCGCACGCCTGCAGCATTCCAGCCTGCTGGCAAACACCTTGCCAACAGCCCCG
GAGCGACACCTGGAGTACGACGATAGCGATAATCTGGTGGGCCTGGCCGAGCGACATGCCACCGGGCAAC
ATCGGCAACTGTTCCATTACGACGCGACCGGGCGAATCATTGCCAGCCAGGACGGCCTGCAGGGCCAGAA
AGAAACCTTCGCCTATGACGCCGCCGCCAATTTGCTTGATGGCCCGAAGGCGGGCGCCGGGCTGGTGGTG
CACAACAAATTGCTGACCTACCAGGACAAGCGCTACCGCTACGATGCCTTCGGGCGAATGATTGAAAAAC
GCAGTGGTCGGCGAGGCGTGCAACGTTTTGCCTACGACGCCGAACACCGGTTGATCGAAGTGCGCAATCA
GACCTCCAGCGGCGAAACCCTGGTCAGGATGCGCTACGACGTCTTGGGTCGCCGCATCAGCAAGAGCGAG
TACGACAGCCAGGGCAACCTTCTGGGTGAAACGCGATTCGTCTGGGATGGCCTGCGGCTGCTGCAGGAAC
AGCGTAATCAACAGACCAGCCTCTATGTCTATGAAGACCTGGGACATGCGCCCCTGGCGCGGGTCGACGG
CCTTGGCGCGCAGCAGAAGATCCGCTACTACCACAACGACCTGAATGGCCTGCCTCAACAGCTTTGCGAG
CCTGACGGCCATAGCGTCTGGCAGGCCCGCTATCAGGTCTGGGGCAATACTGTCGAAGAAATACGCGAGC
CCTACTACATCGAGGAACAGAATCTCAGGTTCCAGGGCCAGTACCTGGACCGCGAGACTGGATTGCACTT
CAACACGTTCCGTTTCTACGACCCGGATATCGGGCGCTTCACCACGCCGGACCCCATCGGCCTGGCCGGA
GGCTTGAACCTTTATCAGTACGCTCCCAACCCAATCGGTTGGATCGATCCGCTGGGCTGGATCTGCAAAT
CGGCCTACAGCGGCAGAAGGGGCACTACAAAAGCCAAAGCTGACCTCGAGAGGAACGGTTTCACTGTGGT
AGGTGAAGAATTGACCATGAAGGTCAAACACCCTGTCACCCAGAAGTCCTATCGCATCAGGGCAGATATC
ATCGCCAAGGACAAAGCCGGCAACTACCACGTGTTCGAAGTCAAAAATGGCAGCGGCAAACTGACCAAGA
ACCAACAGGGATCGGGAATGTTCGACATGAGCAATCCGGCCAATACTAACGGTGGCCTGGGCGGTGGCCT
GATCAAACCGTCGGGCGCTACCCAAGGCCAGTTCGAAGTTGCGACCAAAACCGCCAGAGGTACCCAGTTC
GGTGGCAATGGCGCACAGCATTCGGCCACCTTCTGGCTTCTTCGCTATTGA

Reference
(1) Tang JY, Bullen NP, Ahmad S, Whitney JC (2018). Diverse NADase effector families mediate interbacterial antagonism via the type VI secretion system. J Biol Chem. 293(5):1504-1514. [PudMed:29237732] experimental
 
experimental experimental literature