SecReT6
Effector Protein ID: 73539084
-
SecReT6 ID89
T6SS typeA2
Gene symbol-
Locus tagReut_B5261
StrainRalstonia eutropha JMP134
Repliconchromosome II [GenBank: NC_007348] [Browse all T6SS(s) in this replicon]
Location [Strand]2011957..2012442 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDQ46QH7
KEGG IDreu:Reut_B5261
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.50E-37, Aligned region: 6..147
Protein Sequence: 161 a.a.     [Download]
>gi|73539084|ref|YP_299451.1| unnamed protein product [Ralstonia eutropha JMP134]
MAIPAYMWIKDDGGADIKGSVTVSGREGSVEVVAFDHAVNIPTDSNTGKLTGTRVHKPIVFTKETDASTP
YLYKAVTSGQTLKSIEIKWYKIDDAGKEKEYFNTKLENVKVVGVTPKMLDIKNPAYEKHNHLEDIELRYE
KIIWSYKDGNIIHADSWNERS
-
Nucleotide Sequence: 486 bp     [Download]
>gi|73537298|ref|NC_007348.1|:c2012442-2011957 Ralstonia eutropha JMP134 chromosome 2, complete sequence
ATGGCAATTCCCGCATACATGTGGATCAAGGACGACGGCGGAGCCGATATCAAGGGCTCGGTCACCGTGT
CCGGCCGCGAGGGCAGCGTCGAAGTCGTCGCCTTCGACCACGCCGTCAACATCCCGACCGACTCGAACAC
CGGCAAGCTGACCGGCACCCGCGTGCACAAGCCGATCGTGTTCACCAAGGAAACGGATGCCTCGACCCCC
TACCTGTACAAGGCGGTCACCAGCGGACAGACGCTGAAGTCGATTGAGATCAAGTGGTACAAGATCGATG
ACGCCGGCAAGGAGAAGGAGTACTTCAACACCAAGCTGGAAAACGTCAAGGTGGTCGGCGTCACGCCGAA
GATGCTGGACATCAAGAACCCGGCCTACGAAAAACATAACCATCTCGAGGACATCGAGCTGCGCTACGAG
AAGATCATCTGGTCGTATAAGGACGGCAACATCATTCACGCCGACAGCTGGAACGAGCGCTCATAA